KEGG   Candida tropicalis: CTRG_03195Help
Entry
CTRG_03195        CDS       T01115                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ctp  Candida tropicalis
Pathway
ctp00230  Purine metabolism
ctp01100  Metabolic pathways
Module
ctp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CTRG_03195
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CTRG_03195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 MMR_HSR1 ABC_tran AAA_28 RsgA_GTPase AAA_14 RNA_helicase NACHT KAP_NTPase ATPase_2 AAA_24 AAA_29 AAA_30 AAA T2SSE Adeno_IVa2 Rad17 NTPase_1 DUF2075 cobW DAP3 AAA_23
Motif
Other DBs
NCBI-GeneID: 8299823
NCBI-ProteinID: XP_002548898
UniProt: C5MAV3
Position
Unknown
AA seq 241 aa AA seqDB search
MNHVKTIKKNFLFQMDLFFFFNIYMFNTFSRRIVTTYRRSFISQFANMSSSSSSNSTRPI
VISGPSGTGKSTLLKKLFAEYPGRFGFSVSNTTRKPRPGEVDGKDYNFSSVEEFKQLIEE
EKFIEWAQFSGNYYGTTVKAVKDVAEQGRTCLLDIDMQGVKSVKKTDLNARYLFISPPSI
EELRTRLTGRGTETDESLEKRIAAASAEMEYAETGAHDQIIVNDDLEKAYVEFKKFILEQ
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgtaaagacaattaaaaaaaattttctttttcaaatggatttgttttttttt
tttaatatttatatgtttaatacattttcaagaagaattgttacaacttatagacgttca
tttatatcacaatttgctaacatgtcttcctcctcatcttcaaactccaccagaccaatt
gttatttctggaccatcaggtaccggtaaatccacattattaaagaagttatttgctgaa
tacccaggcagatttggattctctgtttccaacaccaccagaaaaccaagaccaggtgaa
gttgatggtaaagattacaacttcagcagtgttgaagaattcaaacaattaatcgaagaa
gaaaaattcattgaatgggcccaattctctggtaactattacggtaccactgtcaaggct
gtcaaagatgttgctgaacaaggtagaacctgtttattagacattgatatgcaaggggtc
aaatccgttaagaaaactgacttgaatgccagatacctttttattagtccaccatctatt
gaagaattgagaaccagattgactggcagaggtactgaaactgacgaaagtttggaaaag
agaattgctgctgcttcagcagaaatggaatatgctgaaactggtgctcatgatcaaatc
attgtcaatgatgatttggaaaaagcttacgtcgaattcaaaaagtttatccttgagcaa
gaataa

DBGET integrated database retrieval system