KEGG   Candida tropicalis: CTRG_03195Help
Entry
CTRG_03195        CDS       T01115                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ctp  Candida tropicalis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CTRG_03195
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CTRG_03195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MNHVKTIKKNFLFQMDLFFFFNIYMFNTFSRRIVTTYRRSFISQFANMSSSSSSNSTRPI
VISGPSGTGKSTLLKKLFAEYPGRFGFSVSNTTRKPRPGEVDGKDYNFSSVEEFKQLIEE
EKFIEWAQFSGNYYGTTVKAVKDVAEQGRTCLLDIDMQGVKSVKKTDLNARYLFISPPSI
EELRTRLTGRGTETDESLEKRIAAASAEMEYAETGAHDQIIVNDDLEKAYVEFKKFILEQ
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgtaaagacaattaaaaaaaattttctttttcaaatggatttgttttttttt
tttaatatttatatgtttaatacattttcaagaagaattgttacaacttatagacgttca
tttatatcacaatttgctaacatgtcttcctcctcatcttcaaactccaccagaccaatt
gttatttctggaccatcaggtaccggtaaatccacattattaaagaagttatttgctgaa
tacccaggcagatttggattctctgtttccaacaccaccagaaaaccaagaccaggtgaa
gttgatggtaaagattacaacttcagcagtgttgaagaattcaaacaattaatcgaagaa
gaaaaattcattgaatgggcccaattctctggtaactattacggtaccactgtcaaggct
gtcaaagatgttgctgaacaaggtagaacctgtttattagacattgatatgcaaggggtc
aaatccgttaagaaaactgacttgaatgccagatacctttttattagtccaccatctatt
gaagaattgagaaccagattgactggcagaggtactgaaactgacgaaagtttggaaaag
agaattgctgctgcttcagcagaaatggaatatgctgaaactggtgctcatgatcaaatc
attgtcaatgatgatttggaaaaagcttacgtcgaattcaaaaagtttatccttgagcaa
gaataa

DBGET integrated database retrieval system