KEGG   Candida tropicalis: CTRG_03239Help
Entry
CTRG_03239        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ctp  Candida tropicalis
Pathway
ctp00860  Porphyrin and chlorophyll metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTRG_03239
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CTRG_03239
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CTRG_03239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 DAO Pyr_redox
Motif
Other DBs
NCBI-GeneID: 8295961
NCBI-ProteinID: XP_002548942
UniProt: C5MAZ7
Position
Unknown
AA seq 533 aa AA seqDB search
MTLAKLPQNAKVAVLGAGVSGLTFTYFLSKYRPDIKFTIFEKQGRPGGWMFSPSLSIKDT
HKSIVLEKGPRTLRGVKDGTLLMIDILRQLGQEAQVEVLSNKCTANKKYILDSSGEIVQV
PDSVSTALNFAKNVKFVDGNMVFGVLKEPFIKPLKEDETIEQFFKRRLGSTVLTDNVLSA
VVHGIYAGDVGKLSIKSILPFLKDAENQSGSIIKHIFKSISKSKSKPKSGEELSMELQEY
EKSISPNAGLLDMQKKLKNYPMIKFHDGMEVFPKNLASYLVNNTNTNIVYNCSIDSVDPI
SGKVNGEQFDHIRSTINTHGLAKTLPPTNPLVPELKSIQYASIFLTNVYTKTPGLIPKGK
QGFGFLCPRYRKISQNEDALLGTIYDSDVENNVEGLFTGVKPVVSANNKITIMMGGHYYT
HWSIPSNGVNLSIVKKVLESKLKVDLSKFNIRVIKEGEPLELDNMKDDDLIISYNLHVNC
IPQYNLGYQETKSNVDNIIKQDYKLSFGGTVFGEGLGVPDCVIGSFKDALQLK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacattagccaaactaccccagaatgctaaggtggctgttttaggagcaggtgtcctg
ggattaacattcacttatttcttatccaagtatcgtccagatattaaattcaccattttc
gagaaacaaggaagaccaggtggatggatgttttctccctcattatcaatcaaggataca
cataaatcaattgttcttgaaaaaggtcctcgtacattacgtggggtaaaagatgggaca
ttgcttatgattgatatacttcgacaattgggtcaagaagctcaagttgaagtacttagt
aataaatgtactgcaaataaaaaatatatacttgactcatcgggtgaaattgtgcaagta
cctgattccgttagtactgctttgaattttgccaagaatgttaaatttgtggatggtaat
atggtatttggggtattgaaagaaccatttataaagccattgaaggaagatgaaacaata
gaacagtttttcaaaagaagactcggtagtactgtgttgaccgataatgtattgagtgca
gtggttcatgggatttatgctggagatgttggaaaattgagtattaaaagtatattacct
ttcttgaaagatgcagaaaaccaatctggttctattattaaacatattttcaaatctata
tcaaaatcaaaatcaaagccaaagtctggagaggaattgtctatggagttacaagagtat
gagaaactgatctctccgaacgcaggattgcttgatatgcaaaagaaattaaagaactac
cctatgattaaatttcatgatggtatggaagtgttcccaaagaacttggcatcttattta
gtcaataatactaatactaatattgtttacaactgttctatcgatagcgtggacccaatt
tcggggaaagttaacggtgaacaatttgatcacataagatcaactataaacacccatgga
ttggctaagacattacctccaacaaatccactcgttccagaattaaagtccatacaatat
gccagtatttttttaaccaacgtttatacaaaaactccaggattaattccaaaaggaaaa
caaggatttggtttcttgtgtcctaggtatagaaaaatttctcaaaatgaagatgcatta
ttgggaacaatttatgattctgatgtggaaaataatgtcgaagggttgtttactggagta
aaaccagttgttctggctaacaataaaatcaccattatgatgggtggtcattattatacc
cattggtcaattccctcaaacggtgtgaatttgagtattgtaaagaaggttttggaatcg
aaattaaaagtcgacttgtcaaagtttaatatcagagttataaaagagggagaaccattg
gaacttgataacatgaaggacgatgatttaattatctcctataatttacatgtcaattgt
ataccgcaatacaatttgggttatcaagaaaccaaatctaatgttgataacataattaaa
caagactacaaactttcatttggaggaactgtctttggtgaaggacttggtgtacctgat
tgtgtaattgggtcatttaaggatgccttgcaattgaaatag

DBGET integrated database retrieval system