KEGG   Candida tropicalis: CTRG_03247Help
Entry
CTRG_03247        CDS       T01115                                 

Definition
repressible alkaline phosphatase precursor
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ctp  Candida tropicalis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTRG_03247
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CTRG_03247
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTRG_03247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 553 aa AA seqDB search
MGFTNETQALLGGDSLSCLNKKKSNTKRNLSYFLNIITVSIIAYLCFFSTNNNNKKNAPP
TVDPHKKKNIIMMVTDGMGPASLSAARSFRQFRDKLAINDILTLDQYLIGSSRTRSSSSL
VTDSAAGATAFSCAMKSYNGAIGVASDKSPCGTILEALKLQGYYTGLVVTTRITDATPAA
FSSYVDYRFQEDLIAQHQLGEYPFGRAVDLILGGGRCHFLPASKGGCRGDDRDLIEEYSK
TWQYVGDREQFDQLQGGKNVSLPLLGLIANTDIPYAIDRNETEYPSLAEQVKVALTALSD
ATKDSDQGFFLLIEGSRIDHAGHHNDPAAQVREVLAYDEAFEEVIKFIDSSDVETVAIST
SDHETGGLVVARQVSENYPDYLWYPEVLLNSTHSGDYLAHKIADYKNKDDSTKLTKFIKH
EILENVLGVSDYTDKEVQAILDKANDPANLLYVLNNIVSLRAQIGWTTHGHSAVDVNIYA
HTNSPAIKAKLESARAYHGLTGNHENIEIGAFMEEITGSSLSRVTELIRKTEHSPSNNNN
KEVFNADAFHGNV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggctttactaacgaaactcaagccttacttggaggcgattccttgtcatgcttgaat
aagaaaaagtccaacaccaagagaaacttatcctactttctcaacatcataactgtatct
atcattgcatatttatgttttttctcaactaataacaacaacaagaagaatgctccacca
acagtagatcctcataagaaaaagaatatcatcatgatggtcaccgatggtatgggacct
gccagtttatccgcagccagatcattcagacagttccgtgataaacttgccatcaacgat
attttaactcttgatcagtatcttattggatcttcaagaaccagatcatccagcagtttg
gtgacagattctgctgccggagccactgcattctcatgtgccatgaaatcatacaatggt
gccattggtgttgcctcagataaatccccatgtggtaccattttagaagcattgaagttg
caaggttactatactggtttagttgtgactactagaatcaccgatgccactccagctgca
ttcagttcttacgttgattacagattccaggaagatttgattgcccaacaccaattggga
gagtacccatttggccgtgccgtcgatctcattttgggtggtggtagatgtcatttcttg
cctgcctctaaaggcggatgccgtggtgatgatagagatttgattgaagagtacagcaaa
acatggcaatatgttggcgacagagaacagttcgaccagcttcaaggcggtaaaaatgtc
tccttgccattattgggtttgattgccaataccgacattccatatgctattgatcgtaac
gaaacagaatacccatcgttggcagaacaagtaaaagttgccttgactgcgttgtcagat
gctaccaaggattcggaccaagggtttttcttgctcattgaagggtccagaatcgaccat
gcaggacaccacaacgaccctgctgcccaagttagagaagtgttggcctatgacgaagcg
tttgaagaagtcatcaagttcattgactccagtgatgtggaaactgttgctatttctacc
agtgaccacgaaaccggtggtttggttgttgccagacaagtttctgaaaactatccagat
tacttgtggtatccagaagtgttattgaacagcacccattctggtgattacttggctcac
aagattgcagactacaagaacaaagacgattctactaagctcacaaaattcatcaaacac
gaaattttggaaaatgttttgggagtcagtgactacactgataaagaggtacaagctatt
cttgacaaggccaatgatccagctaacttgttgtatgtgttgaacaatattgtgtccctc
agggcgcaaatcggatggaccacccatggccactctgcagttgatgtcaatatctatgct
cacaccaattctcctgccatcaaagccaaattggaatcagcccgtgcataccatggatta
acaggaaaccatgaaaatattgaaattggtgctttcatggaagaaatcaccggatcaagt
ttgagtcgtgtgactgaattgatcagaaaaaccgaacactcaccaagtaacaacaacaac
aaagaggtgtttaatgctgatgccttccatggtaatgtttaa

DBGET integrated database retrieval system