KEGG   Candida tropicalis: CTRG_03290Help
Entry
CTRG_03290        CDS       T01115                                 

Definition
similar to ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ctp  Candida tropicalis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CTRG_03290
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CTRG_03290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MSTKPIVTIIGSLNYDLVSFTKRVPEAGETYQADSFETHMGGKGLNEAIAVSKLSPPETI
ETRMIGKIGTDPFGIHLKQYLIDNKVNVENVDTIEGSSGVAVIMVEEDSGENRILITPGS
NGQLKPSDEQYNEYFPNKDDSSFVILQNEYPDTINTINWLKTNRPKVNIAYNPSPFKSEL
ITSSLLSKIDLLIVNEGEALDVAKHLGILETMPQSIDDEIEKFSNLAKSLQDSINKDNVN
VVIITMGSKGCIYVSKSIPSPSFIKSKKVTKVIDTTGAGDTFFGGVVSNLALGKDIKQAV
EFATSASSLAIQKKGAAEGIPKYEDVFAIL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaaccaatagttacaattatagggtcattaaattatgatttagtttcattt
actaaaagagtccccgaagcaggagaaacatatcaagcagattcatttgaaactcatatg
ggaggtaagggattaaatgaagccattgccgtttctaaattatcaccacctgaaacaatt
gaaactagaatgattggtaaaataggtacagatccttttggtattcacttgaaacaatat
ttaattgataataaagttaatgttgaaaatgttgatacaattgaaggaagttctggagtt
gctgttattatggttgaagaagattcaggtgaaaatagaatattaattactcctggatca
aatggtcaattgaaaccatctgatgagcaatataatgaatatttcccaaataaagatgat
tcttcatttgtaattttacaaaatgaatatcctgatactataaatacaatcaattggtta
aaaacaaatcgtccaaaagttaatattgcatataatccatctccttttaaatcagaattg
attacaagtagtctattatctaaaattgatttattgattgtcaatgaaggtgaagctctt
gatgtagctaaacatttaggaattttagaaactatgccacaaagtattgatgacgaaatt
gagaaattctccaatcttgcaaaatcattacaagattcaatcaataaagataacgttaac
gtagttattattactatgggaagcaaaggatgtatttatgtttctaaatcaattccatcc
ccaagttttattaaatcaaagaaagttactaaagttatagacactactggtgctggcgat
actttctttggtggagtagttctgaatcttgccttgggtaaggatattaaacaagccgtt
gaattcgctactagtgctagtagtttagctattcaaaagaaaggagccgctgaaggtatt
ccaaaatatgaagacgtctttgctattctttag

DBGET integrated database retrieval system