KEGG   Candida tropicalis: CTRG_03315Help
Entry
CTRG_03315        CDS       T01115                                 

Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ctp  Candida tropicalis
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CTRG_03315
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CTRG_03315
Protein kinases [BR:ctp01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CTRG_03315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 405 aa AA seqDB search
MTSMEKGDTSIRSLNDINLQELANRQHQQNIYAQPSPSLENNNNETNNNNNNKDNENSTS
KNNSSTSLGLSKKPSRHVNKDTTTKGKYTLNDFQILRTLGTGSFGRVHLTRSIHNGRFYA
MKVLKKQRVVQMKQIEHTNDERRMLKLAQHPFIIRMWGTFQDCHNLFMIMDYIEGGELFS
LLRKSQRFPTPVAKFYAAEVFLAIEYLHNLDIIYRDLKPENILLDKNGHIKLTDFGFAKE
VQDVTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENI
LNGTITYPDYLPPDILDLLQKLIVKDLTQRLGNLQGGSNDVKNHPWFKEVIWERLLSRDI
ETPYEPPITSGVGDTSQFDRYPEDKDLDYGISGVEDPYRDQFEDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacatctatggaaaaaggagacactagtataagatctttaaacgatatcaatttacaa
gaactagccaacagacaacatcaacagaatatctacgctcaaccttctccttcactagag
aacaacaataacgagaccaacaacaacaacaacaacaaggacaatgaaaatagcacgtcc
aagaataatagcagtacaagtctcggattgagtaaaaaaccatcaagacatgtcaacaaa
gatactactactaaaggcaaatatacattaaatgattttcaaatattacgtacattagga
acaggttcatttggtagagttcatttaacaagatcaattcataatggaagattttatgcc
atgaaagtattgaaaaaacaaagagttgttcaaatgaaacaaattgaacatactaatgat
gaaagaagaatgttaaaattagctcaacatccttttataattcgaatgtgggggacattt
caagattgtcataatttatttatgattatggattatatagaaggtggtgaattgttttca
ttattaagaaaatctcaaagatttccaactcctgtagccaaattttatgctgctgaagta
tttttagctattgaatatttgcataatttagatataatttatcgagatttaaaaccagaa
aatattttattagataaaaatggtcatataaaattaactgattttggttttgctaaagaa
gttcaagatgttacttatactttatgtggtacccctgattatatagctccagaagttgtt
gccactaaaccttataataaatctgttgattggtggagttttggtatattaatatttgaa
atgttgactggttatactccattttatgatcctactccaatgaaaacttatgaaaacatc
cttaatggtacaataacttatcctgattatttacctcctgatattttagaccttttacaa
aaattgattgttaaagatttaacgcaaagattaggtaatttacaaggtggttcaaatgat
gttaaaaatcatccatggtttaaagaagttatttgggaaagattattatcaagagatatc
gaaactccttatgaacctccaattacttctggtgttggtgacacttcacaatttgatcgt
tatcctgaagataaagatttagattatggtataagtggggttgaagatccttatcgtgat
caatttgaagatttttaa

DBGET integrated database retrieval system