KEGG   Candida tropicalis: CTRG_03315Help
Entry
CTRG_03315        CDS       T01115                                 

Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ctp  Candida tropicalis
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ctp04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 405 aa AA seqDB search
MTSMEKGDTSIRSLNDINLQELANRQHQQNIYAQPSPSLENNNNETNNNNNNKDNENSTS
KNNSSTSLGLSKKPSRHVNKDTTTKGKYTLNDFQILRTLGTGSFGRVHLTRSIHNGRFYA
MKVLKKQRVVQMKQIEHTNDERRMLKLAQHPFIIRMWGTFQDCHNLFMIMDYIEGGELFS
LLRKSQRFPTPVAKFYAAEVFLAIEYLHNLDIIYRDLKPENILLDKNGHIKLTDFGFAKE
VQDVTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENI
LNGTITYPDYLPPDILDLLQKLIVKDLTQRLGNLQGGSNDVKNHPWFKEVIWERLLSRDI
ETPYEPPITSGVGDTSQFDRYPEDKDLDYGISGVEDPYRDQFEDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacatctatggaaaaaggagacactagtataagatctttaaacgatatcaatttacaa
gaactagccaacagacaacatcaacagaatatctacgctcaaccttctccttcactagag
aacaacaataacgagaccaacaacaacaacaacaacaaggacaatgaaaatagcacgtcc
aagaataatagcagtacaagtctcggattgagtaaaaaaccatcaagacatgtcaacaaa
gatactactactaaaggcaaatatacattaaatgattttcaaatattacgtacattagga
acaggttcatttggtagagttcatttaacaagatcaattcataatggaagattttatgcc
atgaaagtattgaaaaaacaaagagttgttcaaatgaaacaaattgaacatactaatgat
gaaagaagaatgttaaaattagctcaacatccttttataattcgaatgtgggggacattt
caagattgtcataatttatttatgattatggattatatagaaggtggtgaattgttttca
ttattaagaaaatctcaaagatttccaactcctgtagccaaattttatgctgctgaagta
tttttagctattgaatatttgcataatttagatataatttatcgagatttaaaaccagaa
aatattttattagataaaaatggtcatataaaattaactgattttggttttgctaaagaa
gttcaagatgttacttatactttatgtggtacccctgattatatagctccagaagttgtt
gccactaaaccttataataaatctgttgattggtggagttttggtatattaatatttgaa
atgttgactggttatactccattttatgatcctactccaatgaaaacttatgaaaacatc
cttaatggtacaataacttatcctgattatttacctcctgatattttagaccttttacaa
aaattgattgttaaagatttaacgcaaagattaggtaatttacaaggtggttcaaatgat
gttaaaaatcatccatggtttaaagaagttatttgggaaagattattatcaagagatatc
gaaactccttatgaacctccaattacttctggtgttggtgacacttcacaatttgatcgt
tatcctgaagataaagatttagattatggtataagtggggttgaagatccttatcgtgat
caatttgaagatttttaa

DBGET integrated database retrieval system