KEGG   Candida tropicalis: CTRG_03389Help
Entry
CTRG_03389        CDS       T01115                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ctp  Candida tropicalis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ctp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ctp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ctp00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 551 aa AA seqDB search
MSTPFPKTADKVKGVQILGPIPDDAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQK
LRDQGFLPDFLPETEYIRNDPTWTGPALAPGLIDRRCEITGPTDRKMVINALNSNVATYM
ADFEDSLTPAWKNLVEGQVNLYDAVRRNLTANINGKQYALNLDKGRHIPTLIVRPRGWHL
TEKHVLVDGTPVSGGIFDFAVYFYNSAKEAIAQGFGPYFYLPKMEHHLEAKLWNDIFNYS
QDYIGLKRGTIRASVLIETIPAVFQMDEIIYQLREHSAGLNCGRWDYIFSYIKCLRNHPD
FILPDRSQVTMAAPFMSSYVKLLVHTTHKRKVHALGGMAAQIPIKDDEARNRAALENVTK
DKLREVTLGCDSCWVAHPALVPVVLKVFNEHMKGPNQISLPPKEPFKPITQRDLLSPFVP
GAKITEQGIRANIVIGISYIEAWLRNVGCVPINYLMEDAATAEVSRTQIWQWVTHGAKTD
TGKVITKDYVKQLLDEEYDKLVKNAKPGNKFKRAFEYFAPEALGEKYSDFVTTLIYDDVT
TIGRALPGERL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtctactccattcccaaaaaccgctgataaggtcaaaggtgtccaaatcttgggccca
attccagatgatgccaaacacattttcaaccaagaaactttagcctttgttgccacttta
caccgtggttttgaagctagaagacaagaattgttgaacaacagaaaagaacaacaaaaa
ttgagagaccaaggtttcttaccagatttcttgccagaaactgaatacatcagaaatgac
ccaacatggactggtccagctttggctccaggtttaattgacagaagatgtgaaattact
ggtccaactgatagaaagatggttatcaatgctttaaactccaatgttgctacttatatg
gctgattttgaagattctttgactccagcttggaaaaacttggttgaaggtcaagtcaat
ctttacgatgctgttagaagaaacttaactgccaacattaacggtaaacaatacgccttg
aacttggacaaaggcagacacattccaactttgattgtcagaccaagaggttggcattta
actgaaaagcacgttttagttgatggtactccagtttctggtggtattttcgattttgct
gtctacttttacaacagtgctaaagaagctattgctcaaggttttggtccatacttttac
ttgccaaagatggaacaccacttggaagctaaattgtggaacgacattttcaactactcc
caagactacattggtttgaagagaggtactatcagagcttctgttttaattgaaaccatc
ccagctgtcttccaaatggatgaaattatttaccaattgagagaacacagtgctggtttg
aactgtggtagatgggattacatcttttcttacatcaaatgtttgagaaaccatccagat
ttcattttgccagacagatcccaagttaccatggctgctccattcatgtcttcatacgtt
aaattgttggttcacaccactcacaagagaaaagtccatgcccttggtggtatggctgct
caaattccaatcaaggatgatgaagccagaaacagagctgctttggaaaatgttactaaa
gataaattgagagaagttacccttggttgtgactcttgttgggttgctcacccagctttg
gttccagttgttttgaaggttttcaacgaacacatgaaaggaccaaatcaaatttcctta
ccaccaaaggaaccattcaaaccaatcacacaaagagatttgttgagtccatttgttcca
ggtgctaagattaccgaacaaggtatcagagctaacattgtcattggtatttcttatatt
gaagcttggttgagaaatgtaggttgtgttccaatcaactacttgatggaagatgctgct
actgctgaagtttctagaacccaaatctggcaatgggttacccacggtgccaagactgac
accggtaaagtcatcaccaaagactatgttaaacaattgttggatgaagaatacgataaa
ttggtcaagaatgctaaaccaggtaacaagttcaagagagcctttgaatactttgctcca
gaagctcttggtgaaaaatactctgatttcgttaccactttgatttacgatgatgtcacc
accattggtagagccttaccaggtgaaagattataa

DBGET integrated database retrieval system