KEGG   Candida tropicalis: CTRG_03439Help
Entry
CTRG_03439        CDS       T01115                                 

Definition
similar to YRK
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CTRG_03439
Protein kinases [BR:ctp01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CTRG_03439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 738 aa AA seqDB search
MSNENIALFENKFSQIELNHRMNLDKKLSPTKRKKLLYPQHLYPPQNPGSTISYSESIGN
SGTGNIRVLKTPNLVKTPTTPNRLMSGNTRVSRSRDSSFSSTNGFNTPARERVLSCPMSD
NSSSKQEYQFSFMRDTTSSLQKKQAITPANTSTRILSKSPTTTSSSTKKRLEYARQLSQR
TKRHSSRHSNTSPNISQFHSNTDSDDDKGKLDSLEPSPVRFIDYDKDDNMVIDDSPSKPR
RHVTQPLPNVFDRLYSSPSTTKLPAPKQPKQQSSSPKINYHFKIDSLQQLYQIVFSKCPN
LFSDALSREHQFNLPYDVEDLPLDKLNEYERGEIIRTKEVYYLPEDNLRNINISNHGTNF
GFDDENGNYIIIPKDHVNYRYEIQSNLGTGSFGNVIQAKDHKSSTLVAVKIINNKVNGSL
QQSINEIKMLKTLNDRYDPEKFRFITIVDHFSFRSHMCIISELLSINMYSLLELTNFKGL
GYSVIQSIAQQLLLGLQAIHSCNIIHCDIKPENVMLKLPSSPNSSDFIVKIIDFGSSCFT
NETSFQYIQSRFYRAPEVLFGATYDQKIDIWSLGCLLVEMFTGYPLLPGKNEFEQVGYIV
ELFGPPKPTTILRMRQKLTRKNNQVSLALNDAITSTPTTTSLVSNKKYKKSLLYKIFDHT
GKLNLHNLQQYCNDSSTTSFKKQFKVSSKTLETQMELNKVHLTSTQKQKLLQFLQKMFIL
EPSERSDARDLLSMPFIL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgaaaacattgcattatttgagaataaattctcacagatcgaactaaatcat
agaatgaatcttgataagaaactatctccaaccaaaagaaagaaattgttataccctcag
catttgtatcctcctcagaaccctggaagtacgatatcttattcggaatcaattggcaac
agtggaacaggaaacattcgtgttctcaaaactcccaatcttgtaaaaacccctacgaca
ccaaatagacttatgagtggcaatacaagagtttcacgatcaagagattcatcatttagt
agtaccaacggtttcaatactcctgcgagagaacgtgtgctaagttgtccgatgtcagat
aattcctcactgaaacaggagtatcaattttcatttatgagagatacaacttcatcccta
caaaaaaagcaagccatcacacctgccaatacaagtactcggattcttagcaagtcacca
acaaccacgtcatcatccacaaagaaacgtttagaatatgcacgtcaattgtcacaaaga
accaagagacatagctcaaggcatagtaacacatctccaaatatatctcaattccacagt
aataccgacagtgacgacgataaagggaaacttgattctttggagccatctcccgtgaga
tttatagattatgataaagatgataacatggtaatcgatgactctccatctaaacctcga
agacatgtcacacaaccactaccaaatgtatttgatagattatattcgagcccctcaacc
acgaagttgcctgcaccaaaacaacccaaacaacaatcatcatctccaaagataaactat
cattttaaaatagattcattacaacagttgtatcaaattgtgttctccaaatgtcctaat
ctattttctgatgcactttctagagagcatcaatttaatctaccgtatgatgttgaagat
cttcctttggataagttaaatgagtatgagcgtggagagataatacgaaccaaagaagta
tattatttgccggaagacaatcttcgaaatataaacattagtaatcatggaactaatttt
ggatttgatgatgaaaacggtaattatattatcatacccaaggaccacgttaactataga
tacgaaatacaatcaaacctaggaaccggctcttttgggaacgttatccaagcaaaagat
cacaagtcatcaactttggtggcggtcaaaatcataaataacaaagttaatggatcgctt
cagcaatcgataaatgaaatcaagatgttaaaaacattgaatgatagatatgatccagaa
aagtttagatttatcaccatagtcgatcatttcagtttcagaagtcatatgtgcataatt
tcagaattattatccataaatatgtattccttgcttgagttgacaaactttaaaggatta
ggatacagtgtgattcagagtattgctcagcaattattgttaggtttacaagctattcat
agttgcaatattatccattgtgatataaaacctgagaatgttatgcttaaacttccgtca
tcaccaaactcgtctgatttcattgtcaagattatagattttggttcatcttgttttacc
aatgagactagtttccagtatattcaatcaagattttatcgtgcaccggaagtgttattt
ggcgctacgtatgatcaaaagatagacatttggtcattaggatgtctacttgtcgaaatg
tttactggatatccacttttaccaggtaagaatgaattcgaacaagtgggctacatagtg
gaattatttggacctccgaaaccaaccacaattttgagaatgagacaaaaattgacaagg
aagaataaccaagttctgttggctttgaatgatgctataaccagtaccccaacaactact
tcattggtgctgaataaaaaatataagaaatctttactttacaagatatttgatcatacc
gggaaattgaatttacacaatttgcaacaatattgtaatgattcaagtactacatccttc
aagaaacaatttaaggtttcttcaaaaacactagaaacacaaatggaattaaataaagtt
catttgacatcaactcaaaaacagaaattgcttcaatttttgcagaaaatgtttatatta
gaaccttctgaaagatcagatgcccgtgatttattatcaatgccatttattctataa

DBGET integrated database retrieval system