KEGG   Candida tropicalis: CTRG_03500Help
Entry
CTRG_03500        CDS       T01115                                 

Definition
(RefSeq) anthranilate synthase component II
  KO
K01656  anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
ctp  Candida tropicalis
Pathway
ctp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTRG_03500
Enzymes [BR:ctp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CTRG_03500
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CTRG_03500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS GATase Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 8298026
NCBI-ProteinID: XP_002549203
UniProt: C5MBQ8
Position
Unknown
AA seq 514 aa AA seqDB search
MTTEPSKRHVLMIDNYDSFTWNLYQYLYQSPKCGKVDVFRNDKITISEIENKIKPDIIFI
SPGPGHPLTDSGISRDVIKHFAGKIPIFGVCMGQQCIFEVFGGDVSYAGEIVHGKTTTIK
HDSKGMFEDVPQSVAVTRYHSLAGSSKTLPDVLEVTAVTETQPEIIMGVRHKKYTIEGVQ
FHPESILSESGQLMINNLLGVYGGTWVENESIKKGNVIKKSENILTKIYKQRQLDYETIE
KLPGKSFENLQIELNLDIAPPLINFYDRLKYTQSTLNQTIILSEFKRASPSKGDININAH
PANQALTYATNGCSAISVLTEPHWFKGSLDDLSLIRKVIDKPSTSDYKRPALLRKEFVFS
KYQILESRLAGADTILLIVKMLNDEKLLHELYEYSLDLGMVPLVEVNNSKELKQALKLTY
KGTTEDGLIIGVNNRNLTTFDVDLNTTSSLVDEAKNSDRKGDVLVLALSGISSVDDVKKY
KYDDHVDGFLIGESLMRAEEKGEAGKFLHDLCTC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaaccttctaaaagacatgttttaatgatcgataattacgattcctttact
tggaatttgtatcaatatttgtatcaatctccaaaatgtggtaaagttgatgttttcaga
aacgataaaatcacaatttctgaaattgaaaataaaatcaaacccgatataatttttatt
tccccaggtccaggacatccacttactgattccggtatttctagagatgttattaaacat
tttgctggtaagattcctatctttggtgtttgtatgggacaacaatgtatctttgaagtt
tttggtggagatgtgtcatatgctggagaaattgtccatggtaaaactactaccatcaaa
catgatagcaagggtatgtttgaagatgttccacaatctgttgctgttactagataccat
tctttagctggtagttccaagactttaccggatgttttggaagttactgcagttactgaa
actcaacctgaaattattatgggtgttagacacaagaaatataccattgaaggtgttcaa
ttccatcctgaatctatcttaagtgaaagtggtcaattaatgattaacaatttattgggt
gtttacggaggtacctgggtagaaaatgaatctatcaagaagggtaatgtgattaaaaag
agtgagaatatcttgaccaaaatttacaaacaaagacaattagattatgaaaccattgaa
aaattacctggtaaatcatttgaaaatttacaaattgaattgaatttggatattgctcca
ccattgattaatttttatgatcgtctcaaatacactcaatctactttaaaccaaaccatc
atattatctgaattcaagcgtgccagtccatcaaaaggtgatattaatatcaatgctcat
ccagccaatcaagctttaacttatgcaaccaatggatgttcggcaatttctgttttaact
gaaccacattggttcaaaggttctttagatgatttatctttgattagaaaagttattgac
aaaccatcaacttctgattacaagcgtccagccttgttgagaaaagaatttgttttcagt
aagtatcaaatcttggaaagtagattagcaggtgctgatactattttattaattgttaaa
atgttgaatgatgaaaaattgttacacgaattatatgaatattctttagatttgggtatg
gtaccattagtcgaagtcaacaacagtaaagaattaaaacaagcattgaaattaacttat
aaaggaactactgaagatggtttgataattggtgtcaataaccgtaacttgactaccttt
gatgttgatttaaacactactagttccttggttgatgaagctaaaaacagtgatagaaag
ggtgatgtattagtattggcattatcgggaataagctcggttgatgatgtcaagaagtac
aaatacgacgatcatgttgatgggttcttaataggagaaagcttaatgagagctgaagaa
aaaggtgaagccggtaagttcttacacgatttatgtacttgttaa

DBGET integrated database retrieval system