KEGG   Candida tropicalis: CTRG_03500Help
Entry
CTRG_03500        CDS       T01115                                 

Definition
anthranilate synthase component II
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
ctp  Candida tropicalis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctp01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ctp00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 514 aa AA seqDB search
MTTEPSKRHVLMIDNYDSFTWNLYQYLYQSPKCGKVDVFRNDKITISEIENKIKPDIIFI
SPGPGHPLTDSGISRDVIKHFAGKIPIFGVCMGQQCIFEVFGGDVSYAGEIVHGKTTTIK
HDSKGMFEDVPQSVAVTRYHSLAGSSKTLPDVLEVTAVTETQPEIIMGVRHKKYTIEGVQ
FHPESILSESGQLMINNLLGVYGGTWVENESIKKGNVIKKSENILTKIYKQRQLDYETIE
KLPGKSFENLQIELNLDIAPPLINFYDRLKYTQSTLNQTIILSEFKRASPSKGDININAH
PANQALTYATNGCSAISVLTEPHWFKGSLDDLSLIRKVIDKPSTSDYKRPALLRKEFVFS
KYQILESRLAGADTILLIVKMLNDEKLLHELYEYSLDLGMVPLVEVNNSKELKQALKLTY
KGTTEDGLIIGVNNRNLTTFDVDLNTTSSLVDEAKNSDRKGDVLVLALSGISSVDDVKKY
KYDDHVDGFLIGESLMRAEEKGEAGKFLHDLCTC
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaaccttctaaaagacatgttttaatgatcgataattacgattcctttact
tggaatttgtatcaatatttgtatcaatctccaaaatgtggtaaagttgatgttttcaga
aacgataaaatcacaatttctgaaattgaaaataaaatcaaacccgatataatttttatt
tccccaggtccaggacatccacttactgattccggtatttctagagatgttattaaacat
tttgctggtaagattcctatctttggtgtttgtatgggacaacaatgtatctttgaagtt
tttggtggagatgtgtcatatgctggagaaattgtccatggtaaaactactaccatcaaa
catgatagcaagggtatgtttgaagatgttccacaatctgttgctgttactagataccat
tctttagctggtagttccaagactttaccggatgttttggaagttactgcagttactgaa
actcaacctgaaattattatgggtgttagacacaagaaatataccattgaaggtgttcaa
ttccatcctgaatctatcttaagtgaaagtggtcaattaatgattaacaatttattgggt
gtttacggaggtacctgggtagaaaatgaatctatcaagaagggtaatgtgattaaaaag
agtgagaatatcttgaccaaaatttacaaacaaagacaattagattatgaaaccattgaa
aaattacctggtaaatcatttgaaaatttacaaattgaattgaatttggatattgctcca
ccattgattaatttttatgatcgtctcaaatacactcaatctactttaaaccaaaccatc
atattatctgaattcaagcgtgccagtccatcaaaaggtgatattaatatcaatgctcat
ccagccaatcaagctttaacttatgcaaccaatggatgttcggcaatttctgttttaact
gaaccacattggttcaaaggttctttagatgatttatctttgattagaaaagttattgac
aaaccatcaacttctgattacaagcgtccagccttgttgagaaaagaatttgttttcagt
aagtatcaaatcttggaaagtagattagcaggtgctgatactattttattaattgttaaa
atgttgaatgatgaaaaattgttacacgaattatatgaatattctttagatttgggtatg
gtaccattagtcgaagtcaacaacagtaaagaattaaaacaagcattgaaattaacttat
aaaggaactactgaagatggtttgataattggtgtcaataaccgtaacttgactaccttt
gatgttgatttaaacactactagttccttggttgatgaagctaaaaacagtgatagaaag
ggtgatgtattagtattggcattatcgggaataagctcggttgatgatgtcaagaagtac
aaatacgacgatcatgttgatgggttcttaataggagaaagcttaatgagagctgaagaa
aaaggtgaagccggtaagttcttacacgatttatgtacttgttaa

DBGET integrated database retrieval system