KEGG   Candida tropicalis: CTRG_03622Help
Entry
CTRG_03622        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ctp  Candida tropicalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 650 aa AA seqDB search
MISNRKRPRVLSTEGPSNVLNCDATVATGANRGNGANISTSTTTTNTTSTNISETPPSLY
QSQQQQQQHHSLLLNNHNGNISSDTSTDSTNSFPFYKPLLAAKAKIDSTTFTNPFLSVHD
NHHDHGSSSYALEDDDDDDDLEDDDDDGIEEIDAFDEDDDIIFLEQREIVKRNSDTLLYD
SDALAAYNMFNVNNVAINPDYNRTKKQRTNSLPQLPQVKCFYNKLPNNYVLQTPKLGNIK
TNVIPHHLNLPPCDDENGHYIIKPNDLFANRFVIIKLLGQGTFGKVVQCFDKVKNEHVAI
KIIRNIQKYRDAAKIELRILSTLKKFDHKNDNHCIHLRECFDYRGHICIVTDLLKISLYD
FLENNKYIAFPGSQIQAIAKQLIRSVAYLHDISLIHTDMKPENILLVNDSFQRKPLKSRT
ITSSYLSLGTGSSKKVPKQTKILNNVEIQVIDFGSAIFADEYHSSIVSTRHYRAIEIVLG
IGWSFPIDMWSLGCILVELLTADVLFKTHANLEHLAMIEKVCGERIPPYMIQRAKERNTE
VADMFDDHTLRLKFPTSSTPPKFITSVEEMDRIDLYLSKKIGLDINLDFNISVNFKKNED
KISLGDFTFYYFLFDLIKKLLVIDPDDRITADDALNHPWFNLGTVDEGTI
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgattagcaatcgaaagagaccaagagttttaagtactgaaggaccttcaaatgtttta
aattgtgatgcaacagttgctactggagcaaaccgcggcaacggagcaaatatttctaca
tctaccaccacaacaaatacaaccagcactaatatttcagaaactccaccttctttgtat
caactgcaacaacagcaacaacagcaccatctgttattgctcaataatcacaatggaaat
atttcttctgatacttcaactgattccacaaattctttcccattttataaaccattgttg
gctgcaaaggcaaaaattgattcaacaacttttaccaacccatttttgtctgtccatgat
aatcaccacgaccatggatcctcctcatatgcattagaagatgacgatgatgatgatgat
ttagaagatgatgacgatgatggtattgaggagattgacgcgtttgatgaggatgatgat
attatttttcttgaacaacgtgagattgttaaacgaaacagcgatactttattgtatgac
agtgatgcattggctgcctataacatgtttaatgttaataatgttgccattaatcctgat
tataatcggacaaagaaacaaagaacaaactcgttacctcaattgcctcaagttaaatgt
ttttacaacaagttgcctaacaattatgtgttgcaaacaccaaaattaggcaacatcaaa
acaaatgttataccccatcatttgaatttaccgccgtgtgatgacgaaaatggccattat
ataatcaaaccaaatgatttgtttgccaatcggtttgtcattatcaagttgttgggtcaa
ggtacgtttggtaaagttgttcaatgttttgataaggtgaagaatgaacatgtcgctatt
aagattatcagaaatattcaaaagtatcgtgatgctgccaagattgaattgcgtatcttg
tccacactcaagaaatttgatcacaagaatgataatcattgtatacatttgcgtgaatgt
tttgattatcgaggtcatatttgtattgttactgatttgttgaagatatctttgtatgat
ttcttggaaaacaacaagtatattgcttttccaggatcacaaattcaagctattgctaaa
caattgataaggagtgttgcatatcttcatgatatcagtctaattcacactgacatgaaa
cctgagaatatattgttggtgaatgatagtttccaaagaaaaccattaaagagcagaact
atcacttcttcatacctaagtctagggacaggtagttccaagaaagtacccaagcaaaca
aagattttaaataatgttgaaattcaggtgattgattttggaagtgcgatatttgctgat
gagtatcacagtagtattgttagtactcgacattatcgtgccattgaaattgtcttagga
attggttggtctttccctatagatatgtggtcattgggttgtattttagtggaattatta
acagccgatgtccttttcaagacccatgcaaatttagaacacttggctatgattgagaaa
gtatgtggtgaaagaattcctccatatatgattcaaagagctaaagaaagaaacactgaa
gttgccgatatgtttgatgatcatactttgagattgaaatttccaaccctgtcgactcct
cctaaatttatcacatcagttgaagaaatggatagaattgatttatatttgagtaagaag
attggattagatattaatcttgattttaatatcctggttaattttaagaagaatgaagat
aaaataagtttaggggattttacattttattactttttgtttgatttgatcaagaagttg
ttagtcattgatccagacgatcgaataacggctgatgatgctttgaatcatccatggttt
aatttaggtactgtagatgaaggtaccatataa

DBGET integrated database retrieval system