KEGG   Candida tropicalis: CTRG_03675Help
Entry
CTRG_03675        CDS       T01115                                 

Definition
similar to ubiquitin-specific protease
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ctp  Candida tropicalis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CTRG_03675
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CTRG_03675
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CTRG_03675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 814 aa AA seqDB search
MPFKSSPTSDLDQIALKLTHRIKSNSPTFQQLFNILMDLLKLFDNQIDILNLRGYCDYEV
AYVTYNTCIQVVELIKSKTTPSTMDILTGLQLQTRKRVSTFKTIISHFKKSDTKEEDPLV
NRFKSISGETSQPNHIQDQVFREWITATELQHELTKRRVLLIDYRPQKDYLNNHIKFNDL
VHIEPKIVESLADTATDEELEKLLKSSVLHEQYKKFLDRRKYDLVVIYNYNFGSESSDRF
SGILEIIGKTNPFNKLVKILMNNKYISSRLKVCPSFLSGGVLNWYKVFGDKYLERTIVQN
GVDKASESQYLTSFSDYVSSATKESPPQPHQKLQNGDYVKPSHRKVNQFDPVPVKSVSSI
FASPKVDVKSTPSSSVVSIPLPSTPIVTTPTTLPDVPEKKSSSPINKEVTISSKKSQFLE
SYTTGLVNLGNSCYMNCVVQCLAATPQLTSFFFPTITESFSDHSYRQHINVSNKLGTKGQ
LTTSFVELILNMLNNNERSFSPSKFKKIMGSLSPSQQFLTYDQQDCIEFLNFLLDALHED
LNNVTITDPQERKMITDLSPEQEKSREILPVRLASTIEWERYLKLNFSVIVDYFQGQHLS
QLKCLECGFTSTTYNSFSILSLPIPQKLNNAGKVSLNECLQEFVTTELLDDNNKWYCPRC
KRFTKSTKKIAITRLPQVLIVNFNRFKMTSTGGFNKLETFVTYPVNEVLDMTPYWPDVGS
KINENSTMSIEKEQELLKSFPVRNQTPPFKYKLFGVANHFGNLTTGHYTAYVYKHSDSKK
KRNWCYFDDSKITFNVSPSQVVNKNAYCLFFQRV
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaaatcaagtccaacatctgatttagatcagatagcccttaaacttactcat
agaattaaatccaattcccctacgttccaacagttattcaatatacttatggacttgttg
aagttatttgacaaccaaattgatattttgaatttgagaggatattgtgattatgaagtg
gcgtatgtcacatataacacatgtattcaggtcgtggagttgattaaatcaaagactact
cccagtaccatggatattttgacaggactacagcttcagacacgaaagagagtgagcacg
tttaaaactattattagccatttcaaaaaatctgataccaaggaagaagatcctttagtc
aatagatttaaatcaataagtggagaaacatctcaaccaaatcatattcaagatcaagtg
tttcgagagtggataactgcaactgaactacaacatgaattaacgaaaagaagagtatta
ctaatagattatagaccccaaaaggactatttgaacaaccacataaaattcaatgatttg
gtacatattgaacctaaaatagttgaatcattagcggatactgcaaccgatgaagaattg
gagaagttattaaaatcatcagtactccacgaacaatacaaaaaattcttggatagacgc
aaatacgatttggtagtgatatacaattataactttggatcggaatcaagtgatagattt
tctggtatattggaaataataggaaaaactaatccctttaacaagctcgtcaagattctc
atgaataataaatatatcagttcacgattgaaagtatgtcccctgtttctttcgggagga
gtcttgaattggtataaagtctttggagataaatatttggaaagaacaatagtacaaaat
ggggttgacaaagcttctgaaagtcaatatttaacatcattcagtgattatgtatctagc
gccactaaagaatcacctcctcaaccacaccagaaattgcaaaatggagactacgtaaaa
ccatcgcatagaaaagtgaatcaatttgatcctgtcccagttaagagtgtatcaagtata
tttgcatctcctaaggttgatgtgaaatcaacaccaagttcctcggttgtatcaatccct
cttccatccacccctatagtaaccacaccaactactttgcctgatgttcccgaaaagaaa
tcgtctagtcctattaacaaagaagttactatttcctcaaagaaatcacaatttcttgaa
ctgtataccactggcttagttaatttaggaaattcttgttacatgaactgtgttgttcaa
tgcctagctgcaacacctcaacttacttcattctttttcccgacaatcacagaatccttt
tctgatcattcttacagacaacatataaatgtaagcaacaaattgggtacaaagggtcaa
ttaactacaagttttgttgaattaatcttgaatatgcttaataacaacgaaaggtcattt
agcccttccaagtttaaaaagattatgggctccttatctccctcgcagcagtttcttact
tatgatcaacaagattgtatcgaatttttaaattttcttttagatgcacttcatgaagat
cttaacaatgttacaattacggaccctcaagaacgtaaaatgattacagatttaagtcca
gaacaggaaaagagtagggagatattaccagttagattagcatcaacaatagaatgggaa
agatatctcaaattaaatttttcagtgattgttgattatttccaaggacagcatttatca
cagttgaaatgtttagaatgtggattcacttcaactacttataattcattttcaattctt
tcattacctattcctcaaaagttaaacaacgcgggcaaagttctgttaaatgagtgtctt
caggaatttgtaactacagaattgttagatgataataacaaatggtattgcccaagatgt
aagagatttacaaaactgacaaagaaaatcgccataaccagattaccacaggtgctaata
gtgaatttcaatagatttaaaatgacaagcactggtgggtttaataaattggagacattt
gtcacctacccggttaatgaagtcttggacatgacgccatattggccagatgttggatca
aaaattaatgaaaatagcactatgtctattgaaaaggaacaagaactattaaaatctttc
cctgtgagaaaccagacacctccattcaagtataagctatttggtgttgcaaaccatttt
ggtaatttgacaacaggtcattatactgcttatgtttataaacatagtgattctaaaaag
aaacgaaactggtgttactttgacgattccaaaatcaccttcaatgtttcaccatctcaa
gtggtcaataaaaatgcctactgtttattcttccaaagagtatag

DBGET integrated database retrieval system