KEGG   Candida tropicalis: CTRG_03902Help
Entry
CTRG_03902        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K11482  
histone deacetylase HOS1 [EC:3.5.1.98]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CTRG_03902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 381 aa AA seqDB search
MKQRHVHLALSDNATKICDLLPSNKGRQSLVYGLIKAYNLDQICDDTIEILACSAKELTM
YHSEEFVNHILHTRDNEDHPKEDESYELNKLDKKFGLVYDCYYFPSMDQYIRLTAGSSIL
TAKTIISQQKSSTKQIIGINWYGGRHHCHKSQASGFCYINDIVLSINILRKYLGSVFYLD
LDLHHGDGVENAFKFSKKISTCSIHRYDIGIFPGTGSLKSSATNTFNIPTRKGLNDKSMS
WIIDEVVIPLIEKFGPKSIVIQAGCDGLSTDEHKEWNMSIKGYANSIDTILERFDKTPVM
ILGGGGYNHTETAKCWTYITGKVLQLTDTEQWDIIPDHKELDAYEKDGFQFWTEKNSSYG
KMKDENTKEYLNEIKTYLLSL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgacacgtccatctagcactatcagacaatgcaactaaaatatgtgatttg
cttccgtctaacaaaggacgacaatcattagtttatggactaatcaaagcctataatctt
gatcagatttgtgatgatactatagaaattcttgcctgtctggcgaaagaattaactatg
tatcatagtgaagaatttgtcaaccatatactacacactcgtgataatgaagatcaccca
aaagaagacgagtcatatgagttgaataaattagataagaaatttggacttgtttatgat
tgttattatttcccatcaatggatcaatatatacgactcacagctggatcaagtattctt
acagcaaagacaattatatcccaacaaaaatcatctacaaaacaaatcattggaattaat
tggtatggaggaagacatcattgtcataaatctcaagcatctggattttgttatattaat
gatatagtattatcaattaatattcttcgaaaatatttaggttctgtattttatcttgat
ttagatttacatcatggtgatggtgttgaaaatgcatttaaattctccaagaaaatatca
acttgttcaattcatagatatgatattggaatatttccaggaactggaagtttaaaaagt
tctgctacgaatacatttaatatacctacacgaaaaggattaaatgataaaagtatgagt
tggatcattgatgaagttgttatacctttaattgaaaagtttggtccaaaaagtattgtt
atccaagccggttgtgatggtttatcaacagatgaacacaaagaatggaatatgagtatt
aaaggttatgcaaatagtattgatacaatattagagaggtttgataagacgccagtgatg
attcttggaggaggtggctataatcacactgaaacagcaaaatgctggacatatatcacg
ggaaaggtactacaattgacagatacagaacaatgggatataataccggaccataaagag
ctagatgcttatgaaaaagatgggtttcaattctggacagaaaagaactcatcatatggt
aagatgaaggatgaaaataccaaagagtacttgaatgaaataaaaacgtatttattgtct
ctataa

DBGET integrated database retrieval system