KEGG   Candida tropicalis: CTRG_04034Help
Entry
CTRG_04034        CDS       T01115                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ctp  Candida tropicalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTRG_04034
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTRG_04034
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTRG_04034
Enzymes [BR:ctp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTRG_04034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 701 aa AA seqDB search
MSALLKETFARCKKEGRKALVNFITAGFPTIEDTVPILKNMQEAGVDIIELGVPFSDPIA
DGPTIQQANNVALENGITVPKVLQLLSQAREQGVTVPIILMGYYNPILKYGEQKFLKDAA
DAGASGFIVVDLPPEEAIKFRTECAQHGLSYVPLVAPATSDERLKTLGQIADSFIYVVSK
MGTTGASTKVSSGIEELCARVRKFAGEDTPLAVGFGVSTREHFETVGQVADGVVIGSKIV
TLIGESKPGARGQTAYDYVRSILGEDFKPSYPASFERSNADASKETKAVLEETHKYNPKF
GDFGGQYVPEALHTCLLELEKGFEDAVADPQFWKDFRDLYSYIGRPSSLHKADRLTEHAG
GAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLE
CTVFMGAEDTRRQALNVFRMKILGANVVAVKNGTQTLRDATSEAFRFWVSNLETTHYVVG
SAIGPHPYPTLVRTFQSVIGQETKEQFKELNNGKLPNAVVACVGGGSNSTGMFSPFEHDT
EVKMLGVEAGGDGLDTDRHSATLTAGIPGVFHGVKTYVLQDDDGQVHDTHSVSAGLDYPG
VGPELAYWKSTGRADFIAATDAQALEGFRLLSQLEGIIPALESSHAIYGGVQLAKSLPKD
QHIVINVSGRGDKDVQSVAEVLPRLGEQIGWDLRFEEDPSK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttattaaaagaaacatttgctagatgcaaaaaagaaggacgcaaggccttg
gtaaactttatcaccgctggtttcccaactattgaagataccgtgccaatcttgaaaaac
atgcaagaagccggtgtagatatcattgaattgggtgttcctttctcagatccaattgct
gatggtccaactattcaacaagctaataatgttgccttggaaaacggaatcactgttcca
aaagttttacaattgttatctcaagcaagagaacaaggtgtcactgtcccaattatcttg
atgggttactataatccaattttgaaatatggtgaacaaaaattcttaaaagatgccgct
gatgccggcgctagcggtttcattgttgttgatttaccaccagaagaagccattaaattc
agaactgaatgtgctcaacatggtttatcttatgttccattggttgctccagcaacttct
gatgaaagattgaaaactttgggtcaaattgccgattcttttatttatgttgtttctaaa
atgggtactactggtgcttctactaaagtttcttcaggtatagaagaattatgtgcccgt
gtcagaaaatttgctggtgaagatacccctttggcagttggttttggtgtttcaacaaga
gaacattttgaaacagtgggtcaagttgctgatggtgttgtcattggttccaagattgtg
accttaattggtgaatccaaaccaggtgctagaggccaaaccgcttatgattatgttaga
tccattttgggtgaagatttcaaaccaagttacccagcttcttttgaaagaagtaatgct
gatgcttcaaaagaaaccaaagctgttttggaagaaacccacaaatacaatccaaaattc
ggtgattttggtggtcaatatgtcccagaagctttgcacacttgtttacttgaattagaa
aaaggatttgaagatgccgttgctgatcctcaattctggaaagattttagagatttgtat
tcttacattggtagaccatcttccttgcataaagcagacagattgactgaacatgctgga
ggtgctcaaatctggttaaagagagaagatttgaaccatactggttctcataaaatcaac
aatgctttggctcaagttttaattgccaagagattgggtaagaaaaagattattgctgaa
actggtgctggtcaacatggtgttgccactgctactgcttgtgccaaatttggtttggaa
tgtactgttttcatgggtgctgaagataccagacgtcaagctttgaatgttttcagaatg
aaaattttaggtgccaatgttgttgccgttaaaaatggtactcaaactttaagagatgcc
acttctgaagcatttagattctgggtttctaatttagaaacaactcattatgttgttggt
tccgctattggacctcatccttacccaactttagttagaactttccaaagtgttattggt
caagaaaccaaagaacaatttaaagaattaaacaatggtaagttgccaaacgctgttgtt
gcctgtgttggtggtggttccaattctactggtatgttttctccatttgaacatgatact
gaagttaaaatgttgggtgttgaagcaggtggtgatggtttagataccgatcgtcattct
gctactttaacagcaggtattccaggggttttccatggtgttaaaacttatgttttacaa
gatgatgatggtcaagttcatgatactcattctgtttctgctggtttagattatccaggt
gttggtccagaattggcttattggaaaagtactggtagagctgattttattgctgctact
gatgctcaagctttagaaggttttagattattatctcaattagaaggtattattcctgct
ttagaaagttctcatgctatttatggtggtgttcaattggctaaatctttaccaaaagat
caacatattgttatcaatgtttccggtagaggtgacaaagatgttcaatcagttgctgaa
gtattaccaagattgggtgaacaaattggttgggatttgagattcgaagaagatccatct
aaataa

DBGET integrated database retrieval system