KEGG   Candida tropicalis: CTRG_04034Help
Entry
CTRG_04034        CDS       T01115                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ctp  Candida tropicalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTRG_04034
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTRG_04034
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTRG_04034
Enzymes [BR:ctp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTRG_04034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 701 aa AA seqDB search
MSALLKETFARCKKEGRKALVNFITAGFPTIEDTVPILKNMQEAGVDIIELGVPFSDPIA
DGPTIQQANNVALENGITVPKVLQLLSQAREQGVTVPIILMGYYNPILKYGEQKFLKDAA
DAGASGFIVVDLPPEEAIKFRTECAQHGLSYVPLVAPATSDERLKTLGQIADSFIYVVSK
MGTTGASTKVSSGIEELCARVRKFAGEDTPLAVGFGVSTREHFETVGQVADGVVIGSKIV
TLIGESKPGARGQTAYDYVRSILGEDFKPSYPASFERSNADASKETKAVLEETHKYNPKF
GDFGGQYVPEALHTCLLELEKGFEDAVADPQFWKDFRDLYSYIGRPSSLHKADRLTEHAG
GAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLE
CTVFMGAEDTRRQALNVFRMKILGANVVAVKNGTQTLRDATSEAFRFWVSNLETTHYVVG
SAIGPHPYPTLVRTFQSVIGQETKEQFKELNNGKLPNAVVACVGGGSNSTGMFSPFEHDT
EVKMLGVEAGGDGLDTDRHSATLTAGIPGVFHGVKTYVLQDDDGQVHDTHSVSAGLDYPG
VGPELAYWKSTGRADFIAATDAQALEGFRLLSQLEGIIPALESSHAIYGGVQLAKSLPKD
QHIVINVSGRGDKDVQSVAEVLPRLGEQIGWDLRFEEDPSK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttattaaaagaaacatttgctagatgcaaaaaagaaggacgcaaggccttg
gtaaactttatcaccgctggtttcccaactattgaagataccgtgccaatcttgaaaaac
atgcaagaagccggtgtagatatcattgaattgggtgttcctttctcagatccaattgct
gatggtccaactattcaacaagctaataatgttgccttggaaaacggaatcactgttcca
aaagttttacaattgttatctcaagcaagagaacaaggtgtcactgtcccaattatcttg
atgggttactataatccaattttgaaatatggtgaacaaaaattcttaaaagatgccgct
gatgccggcgctagcggtttcattgttgttgatttaccaccagaagaagccattaaattc
agaactgaatgtgctcaacatggtttatcttatgttccattggttgctccagcaacttct
gatgaaagattgaaaactttgggtcaaattgccgattcttttatttatgttgtttctaaa
atgggtactactggtgcttctactaaagtttcttcaggtatagaagaattatgtgcccgt
gtcagaaaatttgctggtgaagatacccctttggcagttggttttggtgtttcaacaaga
gaacattttgaaacagtgggtcaagttgctgatggtgttgtcattggttccaagattgtg
accttaattggtgaatccaaaccaggtgctagaggccaaaccgcttatgattatgttaga
tccattttgggtgaagatttcaaaccaagttacccagcttcttttgaaagaagtaatgct
gatgcttcaaaagaaaccaaagctgttttggaagaaacccacaaatacaatccaaaattc
ggtgattttggtggtcaatatgtcccagaagctttgcacacttgtttacttgaattagaa
aaaggatttgaagatgccgttgctgatcctcaattctggaaagattttagagatttgtat
tcttacattggtagaccatcttccttgcataaagcagacagattgactgaacatgctgga
ggtgctcaaatctggttaaagagagaagatttgaaccatactggttctcataaaatcaac
aatgctttggctcaagttttaattgccaagagattgggtaagaaaaagattattgctgaa
actggtgctggtcaacatggtgttgccactgctactgcttgtgccaaatttggtttggaa
tgtactgttttcatgggtgctgaagataccagacgtcaagctttgaatgttttcagaatg
aaaattttaggtgccaatgttgttgccgttaaaaatggtactcaaactttaagagatgcc
acttctgaagcatttagattctgggtttctaatttagaaacaactcattatgttgttggt
tccgctattggacctcatccttacccaactttagttagaactttccaaagtgttattggt
caagaaaccaaagaacaatttaaagaattaaacaatggtaagttgccaaacgctgttgtt
gcctgtgttggtggtggttccaattctactggtatgttttctccatttgaacatgatact
gaagttaaaatgttgggtgttgaagcaggtggtgatggtttagataccgatcgtcattct
gctactttaacagcaggtattccaggggttttccatggtgttaaaacttatgttttacaa
gatgatgatggtcaagttcatgatactcattctgtttctgctggtttagattatccaggt
gttggtccagaattggcttattggaaaagtactggtagagctgattttattgctgctact
gatgctcaagctttagaaggttttagattattatctcaattagaaggtattattcctgct
ttagaaagttctcatgctatttatggtggtgttcaattggctaaatctttaccaaaagat
caacatattgttatcaatgtttccggtagaggtgacaaagatgttcaatcagttgctgaa
gtattaccaagattgggtgaacaaattggttgggatttgagattcgaagaagatccatct
aaataa

DBGET integrated database retrieval system