KEGG   Candida tropicalis: CTRG_04248Help
Entry
CTRG_04248        CDS       T01115                                 

Definition
similar to potential ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CTRG_04248
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CTRG_04248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MTKNDSKRVIPLESNPAVFTDLAYNLGLTPVLEFHDVYSLTDKDLLNFLPNPLYAVILLF
PLSKNYEDYRKQQDSINDQPYNNELNNKIKWFKQTIGNGCGLYALLHILTNLPRDLIISN
SKLSNLLDSVKNGLSVDETSLIVEELESEIKLDENFGEKGQTEAPAASESVDLHFITFIK
GKDNHLYELDGRRNGPIDLGESVDESNIIKDPLLTEKIQFYIDNADEANKNNFAIMAIGP
STD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaacgattcgaaaagagtgattccactagagtccaatcctgctgtattcaca
gatcttgcttataatttgggtttaacaccagtattggaatttcacgatgtttattcatta
actgataaagatttattaaactttttacctaatccactttatgctgtgatattattattc
ccattgagtaaaaattacgaagattatagaaaacaacaagattcaattaatgatcaacct
tataataatgaattgaataataaaattaaatggtttaaacaaaccattggtaatgggtgt
ggattatatgcgttacttcatatattgaccaatttaccaagagatttaattatttctaat
tcaaaattatcaaatttattagacagtgtcaagaatggattatctgttgatgaaacctct
ttaattgtcgaagaattggaatcagagattaaattggatgaaaattttggtgaaaagggc
caaactgaagctcctgctgcgtctgaatcagttgatttacattttattacttttataaaa
ggaaaagataatcatttatatgaattggatggtagacgtaatggacctatagatttagga
gaatctgttgatgaatcaaatattatcaaagatcctttgttgactgaaaaaatccaattc
tatattgacaatgctgatgaagccaacaagaataactttgcaattatggcaattgggcct
tcaaccgattaa

DBGET integrated database retrieval system