KEGG   Candida tropicalis: CTRG_04315Help
Entry
CTRG_04315        CDS       T01115                                 

Definition
similar to ubiquitin-specific protease
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CTRG_04315
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CTRG_04315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MVLGTPDKNLPSKPVEKQVFLEDLNKNQLVKVTNEPSGLTNLGNTCYLNSSLQALFQMED
IQNKVRDFSFTGSNQTHDNLVLALKTIFLQMSKKHEAVTPSIFLSLFRRSFPQFSEQVNG
MYKQQDAEEAFSQILTSLRSALKVDDLFRIGFNKETKCLDVPEEATKGFEDAFKLDCHID
VKTNFLRDGILAGLKETIEKHNDTLNADAKYEISKTISRLPKYLTVHFIRFFWKSDINKK
SKILRRVQFPFELDLAEMLDSSIKPEKIANRDTIRKVEKDNLDLIRDFKKAKKDTSLTPL
EQQEEDELKITSIKSKFRDDLSTAMPNINFETSTENPSSVYELNAVITHAGASADGGHYK
AYVKDPTDLDGDRWWLFNDDKVSAVNKEKIETLAGGGESDAALLLIYKGLGF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggttttaggaactccggacaagaatttgccctcaaaaccggttgagaaacaagtcttt
cttgaagatttgaacaagaatcaattggtcaaagttactaatgaaccaagtggattgacc
aatttgggaaatacatgttatttgaattccagtttacaagcattgttccaaatggaagat
attcaaaacaaggttagagatttcagtttcactgggtctaaccaaacccacgataactta
gtgttggcattgaagactattttcttacaaatgtctaaaaaacatgaagctgtgactcca
tctatttttctttcacttttcagaagatcctttcctcaattttcggaacaggttaatggt
atgtacaagcaacaagacgcagaggaggcattctctcaaatcttgacatcattgagaagt
gcattgaaagtagatgatttgttcagaatcggtttcaataaggaaacaaaatgtttagat
gttccagaggaagccactaaaggttttgaagacgcgttcaagttggactgtcatattgat
gtgaagacgaactttttaagagatggtatattggctggattaaaggaaaccattgagaag
cacaatgatacattaaatgctgatgcaaaatatgaaatctccaaaaccatatctagatta
ccaaaatacttgacagttcatttcattagattcttttggaaaagtgacatcaacaagaaa
tcaaagatcttaagaagagtacaatttccatttgaattagatttagctgaaatgttagac
agctccatcaaaccagaaaaaattgcgaatagagacacaattagaaaagtcgaaaaggac
aacttagatttaatcagagatttcaagaaggccaaaaaggatactagcttgactccttta
gaacaacaagaagaggatgaattgaagataacttcaattaagagtaaattcagggatgac
ttgtccactgcaatgccaaatattaactttgagacatcaaccgagaacccttcgagtgta
tatgaattgaatgccgttatcacccatgctggtgcttctgccgatggtgggcattataaa
gcatatgttaaggacccaactgatttggatggtgacagatggtggttatttaacgatgat
aaggttagcgcagttaacaaggaaaagatcgaaacattagctggtggcggtgagagtgat
gcagctttattattgatctacaaaggattgggtttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system