KEGG   Candida tropicalis: CTRG_04399Help
Entry
CTRG_04399        CDS       T01115                                 

Definition
similar to potential compass histone methyltransferase subunit set1p
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ctp  Candida tropicalis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CTRG_04399
Enzymes [BR:ctp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CTRG_04399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1056 aa AA seqDB search
MSYSYRGGRGGYSNRGYRGGGTGSSSSSSAGGGRGGANGSGYRGGYRSSRPGQKEDRYTI
GGMLKLNKGAHYESSDNRYIPNELGSRSPEVKSNKVHTNDGNITSGFNTPVSGSDNKVLT
PISTTTSVPGSDKDTGINEKDSEFAKLSHHSDFTDLLPSSRPVDPRKNFKLLYDIEASKN
DKKLHSKKIRYNGEGIHRHEVTDPRLSNINLYLTKPNKKSKKFPYRQLPQPKIVYDKDSI
GYPPMATIVLWDLPISATELYLRNFLVRYGDAIEALEFKTDPTTAVPLGVVTFKFKGTPE
VAASLAKKFLKIVQNEEPKIDGVPLKARLNDNENLLLSKKIENARHKLLQQRLKREEEEK
KRHQKILEEQKRQELLKKKQEEEQKKQEEAKKKAESDSIIAKNSVVSTRNKNLIYKPNST
VLSIRRKHKIVQGVILPKDLEKYIKNRPYILIHDKHVPTKKISSQDIKRFLKKYDWTRVL
SDKTGFYIVFNSLNECERCFLNEDAKKFFEYKLVMEMAIPEGFSPNGRENESKSISDIFD
EATNVLIKEFQTFLAKDIRERIIAPNILDLLGHEHYPKLVEELKAQEQASKPKVLVSNNN
LKQNALSILEKQRQELQERLKKRKKKNQIIPMQHALDIDSESEIESEDEEEEEDEDEEEE
EEDVEGEDNVSASVSPVDQSLKRERSSTITSVEDEQEHISKKIKIEEKEDIVSDEEMEDA
QVKEEAIVPVKEEEIDSKYKPTEGEPQTVYPEFVSSGVFDLDELKGSIKDDEDLKLAEEV
LAGIEPLGNKNIDYWSWKLKDTKSTEEIAEEVENIEELPANLESTTGAFKSEGYKKIPDP
DKIGYLPHRRKADKPIKTIQYEDDNDEKGNDNSNAVQSSRVNRANNRRFAADITAQIGTE
SDVLSLNALTKRKKPVTFARSAIHNWGLYALEPIAAKEMIIEYVGERIRQQVAEHREKSY
LKTGIGSSYLFRIDENTVIDATKKGGIARFINHCCSPSCTAKIIKVEGIKRIVIYALRDI
EANEELTYDYKFERETNDEERIRCLCGAPGCKGYLN
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatagctatagaggtggtcgtggtggatatagtaatcgtggctaccgtggaggc
ggtactggaagtagtagcagcagtagtgctggtggtggccgtggtggagcaaatgggagt
ggatatagaggaggatacagatcaagcagaccgggtcagaaagaggatagatatactatt
ggtgggatgcttaaactcaacaaaggtgcccattatgaatcaagcgataatagatatatt
ccaaatgaattaggttcccggtcaccagaagtaaaatcaaacaaagtacatacaaatgat
ggaaatatcacatctggcttcaacactccagtctcggggtctgacaataaagtattaact
cctatatcaacaacaaccctggtacctggaagtgataaagatacaggaataaatgaaaag
gattccgaatttgcaaaattatctcatcattcagatttcacagatttactcccatcatca
cgaccagttgatcctagaaagaatttcaaacttttatatgacattgaagcatctaaaaat
gataaaaaactacattctaagaaaattcgatacaatggagaaggtatacatcgtcatgaa
gtcactgatccccgattaagtaacataaatttgtacttgaccaaacctaataagaaatct
aagaaattcccttatagacaattaccccaacctaagatagtatatgacaaagattcaata
ggataccctccaatggccaccattgtattatgggatttaccaatatcagcaactgaatta
tatttgaggaatttccttgtgagatatggagatgcaattgaagcacttgaattcaagacc
gatccaactacagccgtgccactcggtgtagttacttttaaattcaaaggtacaccagaa
gttgccgcaagtttggccaaaaaatttctcaagatagtacagaatgaagaacccaaaatc
gatggagttcccttgaaagcacgtttaaatgataatgagaatttattattgagcaaaaag
atagaaaatgcaagacataagttattgcaacaacgcttgaaaagagaagaagaggaaaag
aagagacatcaaaaaatacttgaggaacaaaagagacaagaacttttaaagaaaaaacag
gaagaggagcagaagaaacaagaagaggccaagaagaaagctgaactggattcaattata
gccaaaaatagtgttgtatccactagaaataaaaacttgatctacaaaccaaattcaaca
gtactttccattagaagaaagcataaaatagttcaaggagttatattacctaaagatttg
gagaaatacatcaagaatcgaccatatatattgatacatgataaacatgttccaaccaaa
aagatttcgtcacaagatatcaagagatttctcaagaaatatgattggacaagggttttg
tctgacaaaactggattctatattgtattcaattcgcttaatgaatgtgaaagatgtttc
ttgaacgaggacgctaaaaagttttttgagtataaattggttatggaaatggcaattcca
gaaggtttctcaccaaatggtagagagaatgagtctaaatcaatcagtgatatttttgat
gaagcgacaaatgtgttaattaaagaattccagacatttttggccaaagatattagagag
agaatcattgctccaaatattttagatttattgggccatgaacattatccaaaattagtc
gaggagttaaaagcacaagaacaagcatctaaacccaaagttctagtatcaaacaataat
ttaaagcaaaatgcattatctattcttgaaaaacaacgacaagaacttcaagagaggttg
aagaaaagaaagaagaaaaaccagatcattccaatgcaacatgctcttgatattgacagt
gagtccgagattgaatccgaagacgaggaagaagaagaagacgaagacgaggaagaggaa
gaagaggatgttgaaggagaagacaacgtcagtgcgtctgtttcaccagtcgatcaatca
ttaaaacgagaacgaagctcgactatcacaagcgtggaggatgagcaagaacatatttcc
aaaaagattaaaattgaggaaaaagaagatattgtttctgatgaagaaatggaagatgct
caagtcaaagaagaagctattgttcctgttaaggaagaagaaattgacagtaaatataag
ccaacagaaggtgaaccacaaactgtttatcctgagtttgtgtcgtctggtgtatttgat
ttggatgagttgaaaggatccattaaggatgacgaagatttgaaacttgctgaagaagtg
ttggcaggaattgaacccttgggtaataagaatattgattactggtcatggaaattgaag
gataccaagagtacagaagaaattgctgaagaggttgagaatattgaagaattgccagca
aacttggaatcgacaacaggagctttcaaaagtgaaggttataagaagatccctgatcct
gataaaattggatatttaccacaccgtagaaaagcggataaaccaatcaagacaattcaa
tatgaggatgacaatgatgagaaaggtaatgataattccaatgcagttcaaagttcacgt
gttaatagagctaataatagaagatttgcagctgatatcacagcacagattggaactgaa
tcagatgtattgagtttgaatgcgttgacaaagagaaagaaaccagttacttttgctaga
tctgcaattcataattgggggttgtatgcattggaaccaattgctgctaaagaaatgatt
attgaatatgtcggagaacgaattagacaacaagttgctgagcatagagaaaaaagttat
ttgaaaacaggtattggatcttcatatcttttcagaattgatgaaaatacagttattgat
gctaccaaaaagggaggtattgctagattcattaatcattgttgtagtcctagttgtaca
gccaagatcatcaaagttgaaggtatcaaaagaattgtcatttatgcattgagagatatt
gaggccaatgaagaactaacttatgattataaatttgaaagagaaaccaatgatgaagaa
cgtattagatgtttgtgtggagcacctggctgtaaagggtatttgaattaa

DBGET integrated database retrieval system