KEGG   Candida tropicalis: CTRG_04547Help
Entry
CTRG_04547        CDS       T01115                                 

Definition
similar to raptor protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ctp  Candida tropicalis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1456 aa AA seqDB search
MSLQQQSYSVVPRRPPVQPLNDKMRHGFDVDYNSEKFLSSLANTFYIYFDDKRQNTNGNP
ITDEMKASPKHFKNYQPISDWKVMKERQKTISAILVLCLNLGVAPPDVMKPSPCARFESW
CDPSLFTDTKKAIENIGKNLQLQYESISSKTRYRLSLDPCVEDIKRFCNAQRRNAKDERI
LFHYNGHGVPKPTASGEIWVFNRNYTQYIPISLYDLQTWLGAPVIFVYDCNSAGNIVHNF
KKFVQKRIDDDNEGNHDQSAPSPSSAYLDCIQLAACKSNELLPMSPDLPADLFTCCLTSP
IDISVRWFILQSSLKKGYYDALPRNSIGNVIIPGNLNDRRTPLGELNWIFTAITDTIAWT
LLSRPIFKRLFRQDLMVAALFRNFLLAKRIMPHLNCNPISDPPLPEAVRFHPIWDSWDLA
IDQVLSKLLRTAQDEAAVAAAAAASTTNGVIPGSVPSSTTASNSLAPNGTAKSDGHQGNG
SVSHVPAAPQNSGNYQYTTFFEQQLTAFDIWLKYAGPSTKEPPQQLPIVLQVLLSQVHRL
RALILLSQFLDLGPWAVYLSLAIGIFPYVLRLLQSPAQELKPVLIFIWARIMAVDYKGTQ
QELCKDKGYNYFYLILNSNPTNNVNGSHNPNNATGAGAMLINDDHKAMSAFILTLFIKDF
KNGQRLCYSTEIINNCLKFIQTSDNPLLRQWCSLLLSQLWNRYPDGKWIVYKNGYINKLL
TLIDDPIPEVRTSILVALTTYLSDPPHLAAPQPTNPVAVNTTDLRKDEIRQQDLKLANAV
LGLLGDGSPIVRKELVFFINKFVQTYSKFFLIVAFNQLQEEIVLIENPNYLNDFRKRSPA
YGSIFSSIWKALLILSEDPHCEVKQLAETLIDYVMVQLNESELSALVKEMQDYLLSKSTI
NISESFKPTKPLVNRQLGDKRQVSSASVMNRKNVLKIDGSSLVTRSASASNLGGNNANSD
NSDAESITSKLKNLSVSKLFKSFHITEENDLKSLSRILNPGPIQSSYGSEYVPTPSFYKK
RDLTEPPELPFDSGFFEYSCEYFQEPQMSRNEIDEPGSKEYVKRLWRRNRNESIIQETQP
QKEMALRGEWNKDIQILNNKTQPKCIKFTQFEKILVASDEKDNITVWDWENNQVVKKFSN
GNPFGTKITDIKFLNEDDSPLMLTGSSDGVIKIYKNFHNYENYGTTSNGGIIRDEDGDDD
IEEEEKKVELVTGWRALTDLLLTSKSTGLVSEWQQSRGSLLVSGDVKIIRIWDAPRELCL
SDIPARSSSSITSLTSDQVAGDIFIAGFDDGTIRVYDTRLDSRESMVMTWKSPRQQQQQQ
QQQGQQFIGTGSIRNVHMQRGGFRELISGSADGYVNVWDLRLQNPVLTYTTPEKSIRSMD
VHEHAPISMTGVKNVDIWSTAGECLTTLNNPNGSSHKSLNYLSTATFHPHRMMFATNYNQ
DGHINVYTCKDTIVQY
NT seq 4371 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttacaacaacaatcatattcagttgttcccaggcgacctccagttcagcctttg
aatgataaaatgagacacggtttcgatgttgactataattctgaaaaatttctaagttca
ttagcgaacacattctatatatactttgatgacaaacgacaaaacacaaatggtaatcca
attactgatgagatgaaggcatcgccaaagcattttaagaattaccaaccaatatctgac
tggaaagtcatgaaagaacgtcaaaagacaatcagtgcaatattggtgttgtgtctaaat
ctaggagttgcgcctccagatgtgatgaagccttctccatgtgcacgctttgaatcatgg
tgtgatccatctttattcactgatacaaagaaagcaatagagaatatcggtaaaaattta
caattacagtacgaaagtatatcgtcaaaaaccagatatagattgtccttagacccttgc
gttgaagatatcaaacgtttctgcaatgctcagcgaagaaatgccaaggatgaaagaata
ttgtttcattacaatgggcatggtgttcctaaaccgactgcaagtggagaaatttgggtg
ttcaacaggaactacacacaatatattcctatttccttatatgatcttcaaacttggctt
ggggcccctgtgatctttgtctatgattgtaatagtgcaggcaatatagttcataatttc
aaaaagtttgttcaaaaacgtattgatgacgacaacgagggtaatcacgatcaaagtgct
ccttcgccttcttcagcgtatttagattgcatacaattggcagcatgtaaaagcaatgaa
ttgttaccaatgagtcctgacctaccggcagatttgtttacttgttgtttaactagtcca
atagatattagtgtcaggtggtttattcttcaaagttccttaaagaaaggatactatgat
gctttacctaggaactcaataggcaatgtcattattccaggtaatttaaatgatagaaga
acaccgcttggtgagttaaattggattttcacagcaattacagatactattgcgtggacc
ttgttatcaagaccaattttcaaacgcttgtttagacaagatttaatggtagctgcattg
ttcagaaactttcttttggcaaagagaatcatgcctcatttaaactgtaatccaatcagt
gatccaccattaccagaagctgttagatttcatccaatttgggattcgtgggatttagcc
atagatcaagttctttcaaagctattaagaactgcgcaagatgaggctgctgttgctgct
gctgctgctgcttccaccactaatggtgtcatacctggttctgttccttctagtacaact
gcatcaaattcattagctccaaatgggacagctaaatctgacggacatcaaggtaatggt
agcgtttcacatgttcctgctgctcctcagaattcaggaaactaccaatatactactttt
tttgaacagcaattaactgcgtttgatatatggttaaaatatgctggtccttcaacaaaa
gagccaccacagcaattgccaattgtgttgcaagttttgttgtcccaagtccatagattg
agagcattaatattgttgtcacagtttttagatttgggaccttgggctgtctatttgtcg
ttggctattggtatatttccgtatgttttgaggttactacaaagtccagcacaagagttg
aagccagtattaatattcatttgggctagaattatggctgttgactacaagggaactcaa
caagagctttgtaaggataaaggctacaattacttctacttaatattaaattcaaaccct
acaaataatgtgaatggttcacacaatccaaataacgcaactggagctggtgccatgctt
attaatgacgatcacaaggctatgagtgcgtttattttaaccctatttatcaaagatttc
aaaaatgggcaacgattatgttattccacagagataattaacaattgtttgaaatttata
cagaccagtgataatcctttacttagacaatggtgcagtttattgttatctcaattatgg
aatagatatcccgacggtaaatggatagtttacaagaatggatatataaacaaattgttg
acattaattgatgatcctataccagaagttagaacatccatcttggttgcgttgaccacc
tacctttctgatccaccacatttagctgcaccacagcctacaaacccggttgcagttaat
actacagatttgagaaaagatgaaattagacagcaagacttaaagttggccaatgctgtg
cttgggttattaggagatggttctccaattgttagaaaagaattggtatttttcatcaat
aaatttgtccaaacatattctaaatttttcttgattgttgcgtttaatcaattacaagaa
gaaattgtcttaattgagaatccaaactatttgaatgattttagaaaacgctcaccggcc
tatggatcaatatttagttcaatctggaaagctttattgatattatcagaagatccccat
tgtgaagtcaaacaactcgcagagacattaatcgattacgttatggtccaattgaatgaa
agtgagttatctgctttggtcaaagaaatgcaagattatttactaagcaagtcaactatt
aatatcagtgaaagtttcaagccaacaaagccactagtaaatagacaattgggtgataag
agacaggtttcaagtgcatcagtgatgaatagaaagaatgtcttaaaaatagatggttct
tctttagtaacaagatccgcttcagctagcaatctcggtgggaataatgcaaattctgac
aattcagatgcagaatctataacttctaaattgaagaatttatctgtgtctaagcttttc
aaaagttttcatatcacagaagaaaatgatttgaagagtctaagcagaatattaaaccca
ggaccaatacagtcaagctatggtagtgagtatgttccaacaccttctttttacaagaaa
cgtgatttgactgaaccgcctgaattaccatttgattctgggttctttgaatacagttgt
gaatatttccaagaacctcaaatgtcaagaaatgagattgatgaacctggctcgaaagaa
tatgtcaagagactatggagaagaaatagaaatgagtctatcattcaagaaactcaacca
caaaaggaaatggcattgagaggcgagtggaataaagatattcaaattcttaataataaa
acacagcctaaatgtatcaaattcactcagtttgaaaaaatcttagttgccagtgatgaa
aaggataatatcaccgtttgggattgggaaaataatcaagttgtaaagaaattttccaat
ggtaatccattcggaacaaaaatcactgacattaagtttttaaatgaagatgattcccca
ttaatgttgacagggtcctctgatggggtgatcaagatttataaaaacttccataattac
gaaaattatggaactacctcgaatggtggaattatcagggatgaagacggagatgatgat
attgaagaggaagagaagaaagtggaattggttactgggtggcgagcattgactgatttg
ttgttgacttcaaagagtactgggttagtttcagaatggcaacaatcaagaggttcgtta
ttggttagtggtgatgtgaaaatcattagaatttgggatgccccacgtgaattatgtttg
ctggatattcctgctagatcgtcgtcgtcaatcacctctttaacttctgatcaagttgct
ggtgatatttttattgctggtttcgatgatggtactatccgagtttacgataccagattg
gactcacgagaatcaatggtaatgacgtggaaatcaccaagacaacagcaacaacaacaa
cagcaacaaggtcagcaatttattggaacaggctcaattagaaatgttcatatgcaaaga
ggtggtttcagagagttgattagtggttcagctgatgggtatgtgaatgtttgggatctt
aggttgcaaaatccagttttgacttacaccaccccagagaaatctatccgaagtatggat
gttcatgaacacgctccaatttccatgactggtgttaaaaatgttgacatttggtctact
gcaggagaatgtttgaccacattgaataatccaaatggttcatcccacaaatcattgaat
tatttatcaaccgcaactttccatccacatagaatgatgtttgcaacaaattataatcaa
gacggtcatattaacgtctatacatgtaaagatacaatagtgcagtattag

DBGET integrated database retrieval system