KEGG   Candida tropicalis: CTRG_04578Help
Entry
CTRG_04578        CDS       T01115                                 

Definition
similar to D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ctp  Candida tropicalis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ctp00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ctp00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:ctp00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ctp04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MTSVVVLGAGVIGLTTALELKRWNPDLDITIAAHHWPGDIHPSYTSPYAGANWQSFASPE
DKELQEIDKPGYKKFLQLAESDPRAGVWATENLSYYTDYEVSAAKGNFKEIIPWYRDFVD
DFKIIDSSKLPAGIAFGHSFKGLVVSVPTYLKYLVQQNKEIGNKLKKVPIIYNIESARDF
HSSGKKADYVINATGLDATTIKGVDDDKLTFPVRGQVLLLKNNARIQYHVHGFPGFPNEL
LYIMPRKEGGTIVGGCFLPGERNTAEDKELTERIIRRALKYAPELVDPTFKNNPSKIEIA
QVNVGFRPFREDGARVELDKKRKWLIHNYGAGGGGYQGSFGLANKVIDIMKNELSKGKSK
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacactggtagtcgtattaggagcaggggttattggtttaacaactgccttggaatta
aaacgctggaatcctgacttggatatcactattgccgctcaccactggccaggagatatc
catccttcttatacttctccttatgctggagcaaactggcaatcatttgcttctcctgaa
gataaagagttacaagaaattgacaaaccaggttataagaagtttttgcaacttgctgaa
tctgacccaagagctggtgtttgggccactgagaatctttcttattacaccgactatgaa
gtttctgcagcaaagggcaacttcaaggaaataatcccttggtatagagattttgttgat
gattttaaaattattgatagcctgaaattgccagcaggtattgcttttggacatagtttc
aaaggattggttgtttccgtaccaacttacttgaaataccttgttcaacaaaacaaagaa
ataggtaacaaacttaagaaagttccaatcatctacaacattgaatcggccagagatttc
catagttctggtaaaaaagccgactatgtcatcaatgcaactggtttagatgcaaccacc
atcaaaggtgttgacgatgataagcttactttcccagttagaggtcaagttttgcttctt
aagaacaatgctagaatccagtatcatgttcatggattcccaggtttccctaacgaattg
ctctacatcatgccaagaaaagaaggaggtaccattgtcggtggatgtttccttcctggt
gaaagaaatactgctgaagataaggagttgaccgaaagaattatcagaagagctcttaag
tacgctccagaattggttgacccaacttttaaaaacaatcctctgaagattgaaattgct
caagttaatgttggtttcagaccatttagagaagatggtgctagagttgaattggacaag
aagcgtaaatggttaattcacaattatggtgctggtggtggtggataccaaggaagtttt
ggattggccaacaaagttattgatattatgaaaaacgaattatcaaaaggaaaatccaaa
ttataa

DBGET integrated database retrieval system