KEGG   Candida tropicalis: CTRG_04578Help
Entry
CTRG_04578        CDS       T01115                                 

Definition
similar to D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ctp  Candida tropicalis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTRG_04578
   00330 Arginine and proline metabolism
    CTRG_04578
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CTRG_04578
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    CTRG_04578
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CTRG_04578
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     CTRG_04578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MTSVVVLGAGVIGLTTALELKRWNPDLDITIAAHHWPGDIHPSYTSPYAGANWQSFASPE
DKELQEIDKPGYKKFLQLAESDPRAGVWATENLSYYTDYEVSAAKGNFKEIIPWYRDFVD
DFKIIDSSKLPAGIAFGHSFKGLVVSVPTYLKYLVQQNKEIGNKLKKVPIIYNIESARDF
HSSGKKADYVINATGLDATTIKGVDDDKLTFPVRGQVLLLKNNARIQYHVHGFPGFPNEL
LYIMPRKEGGTIVGGCFLPGERNTAEDKELTERIIRRALKYAPELVDPTFKNNPSKIEIA
QVNVGFRPFREDGARVELDKKRKWLIHNYGAGGGGYQGSFGLANKVIDIMKNELSKGKSK
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacactggtagtcgtattaggagcaggggttattggtttaacaactgccttggaatta
aaacgctggaatcctgacttggatatcactattgccgctcaccactggccaggagatatc
catccttcttatacttctccttatgctggagcaaactggcaatcatttgcttctcctgaa
gataaagagttacaagaaattgacaaaccaggttataagaagtttttgcaacttgctgaa
tctgacccaagagctggtgtttgggccactgagaatctttcttattacaccgactatgaa
gtttctgcagcaaagggcaacttcaaggaaataatcccttggtatagagattttgttgat
gattttaaaattattgatagcctgaaattgccagcaggtattgcttttggacatagtttc
aaaggattggttgtttccgtaccaacttacttgaaataccttgttcaacaaaacaaagaa
ataggtaacaaacttaagaaagttccaatcatctacaacattgaatcggccagagatttc
catagttctggtaaaaaagccgactatgtcatcaatgcaactggtttagatgcaaccacc
atcaaaggtgttgacgatgataagcttactttcccagttagaggtcaagttttgcttctt
aagaacaatgctagaatccagtatcatgttcatggattcccaggtttccctaacgaattg
ctctacatcatgccaagaaaagaaggaggtaccattgtcggtggatgtttccttcctggt
gaaagaaatactgctgaagataaggagttgaccgaaagaattatcagaagagctcttaag
tacgctccagaattggttgacccaacttttaaaaacaatcctctgaagattgaaattgct
caagttaatgttggtttcagaccatttagagaagatggtgctagagttgaattggacaag
aagcgtaaatggttaattcacaattatggtgctggtggtggtggataccaaggaagtttt
ggattggccaacaaagttattgatattatgaaaaacgaattatcaaaaggaaaatccaaa
ttataa

DBGET integrated database retrieval system