KEGG   Candida tropicalis: CTRG_04588Help
Entry
CTRG_04588        CDS       T01115                                 

Definition
similar to cyclin
Orthology
K06634  
cyclin H
Organism
ctp  Candida tropicalis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ctp03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ctp03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MSEPSKSPEVTEPPVKKPRITNDDLYRNSTQFELWSFTPDNLKDTKRHANEKGAKVSKEK
FDIAYNKAKQENPDVFAKYPEELNESMISILTPEEESTYLDFYIQNITTTCNFFKMPTQV
RLTAASFFKKFYLVNSVMEFHPKNVLYTCIFLAAKSENYFISIESYVKALKGTDASHILD
LEFIVLQSLKFTLLVHHPIRPLYGFFLDFQAVLLHPEQVIYDVSVDTLGNLYNQAKEWLN
KYFMVSDVAFLFTPPQIALAAMYDTDKRITERYLKRKFLKDEPKLDAIKEEQEQPKLNEE
PKQEGESKDKSNAQSNEKPDGEAQVQPKIKSSNREQYETLVKSIRRCIRIAKQSQIADRE
ASKEIDKKCFFALNPKKLIDKRIKRLTTAATDGAKETTAEPK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccatctaaatcacctgaggttacagaaccacctgttaagaaaccaagaatt
accaatgatgacttgtacagaaactcaacacaatttgaactatggtcattcactccagat
aatcttaaagacactaaacgacatgcaaatgaaaagggagctaaagtctctaaagaaaaa
tttgatattgcttataataaagcaaaacaggaaaacccagatgtatttgcaaaataccct
gaagaattgaatgaatcgatgattagtattttaactcctgaagaagaatctacatatctt
gatttttatatccagaatataactacaacatgtaattttttcaaaatgcctacacaagta
cgattgacagctgcatcattttttaaaaagttttatctagtgaattcagtaatggaattt
catcctaagaatgtattgtatacatgtatatttttggcagcaaaatcagaaaattatttc
atatcaattgaatcttatgttaaagcattgaaaggaacagatgcatctcatattttagat
ttggaatttattgtattacaaagcttgaaatttacattactagtgcatcatccaattcgt
ccattatatgggtttttccttgatttccaagcagtattattacatccagaacaagtgatt
tatgatgtttccgttgatactttgggtaatctatataatcaagctaaagaatggcttaat
aaatatttcatggttagtgatgtggcgtttttatttacacctccacaaattgcccttgct
gctatgtatgacacagataaaagaataacggagagatacttgaaaagaaagtttttaaaa
gatgaacctaaattggacgctattaaagaggaacaagaacaaccaaagctaaacgaggaa
ccaaaacaagaaggtgaatcaaaagataagtctaatgcacaatcaaatgaaaaacctgat
ggcgaagcacaagtacaaccaaaaataaaatcatcaaacagagaacaatatgaaacgtta
gtgaaatcgataagaagatgtattagaattgcaaagcaatcacaaattgctgatcgtgaa
gcaagtaaagaaattgacaaaaaatgtttctttgcattaaatcctaaaaaattgattgat
aaaaggataaagagactaacgactgctgctacagatggtgctaaagaaacaacagctgaa
cctaaatag

DBGET integrated database retrieval system