KEGG   Candida tropicalis: CTRG_04588Help
Entry
CTRG_04588        CDS       T01115                                 

Definition
similar to cyclin
Orthology
K06634  
cyclin H
Organism
ctp  Candida tropicalis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CTRG_04588
  Replication and repair
   03420 Nucleotide excision repair
    CTRG_04588
Transcription machinery [BR:ctp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CTRG_04588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MSEPSKSPEVTEPPVKKPRITNDDLYRNSTQFELWSFTPDNLKDTKRHANEKGAKVSKEK
FDIAYNKAKQENPDVFAKYPEELNESMISILTPEEESTYLDFYIQNITTTCNFFKMPTQV
RLTAASFFKKFYLVNSVMEFHPKNVLYTCIFLAAKSENYFISIESYVKALKGTDASHILD
LEFIVLQSLKFTLLVHHPIRPLYGFFLDFQAVLLHPEQVIYDVSVDTLGNLYNQAKEWLN
KYFMVSDVAFLFTPPQIALAAMYDTDKRITERYLKRKFLKDEPKLDAIKEEQEQPKLNEE
PKQEGESKDKSNAQSNEKPDGEAQVQPKIKSSNREQYETLVKSIRRCIRIAKQSQIADRE
ASKEIDKKCFFALNPKKLIDKRIKRLTTAATDGAKETTAEPK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccatctaaatcacctgaggttacagaaccacctgttaagaaaccaagaatt
accaatgatgacttgtacagaaactcaacacaatttgaactatggtcattcactccagat
aatcttaaagacactaaacgacatgcaaatgaaaagggagctaaagtctctaaagaaaaa
tttgatattgcttataataaagcaaaacaggaaaacccagatgtatttgcaaaataccct
gaagaattgaatgaatcgatgattagtattttaactcctgaagaagaatctacatatctt
gatttttatatccagaatataactacaacatgtaattttttcaaaatgcctacacaagta
cgattgacagctgcatcattttttaaaaagttttatctagtgaattcagtaatggaattt
catcctaagaatgtattgtatacatgtatatttttggcagcaaaatcagaaaattatttc
atatcaattgaatcttatgttaaagcattgaaaggaacagatgcatctcatattttagat
ttggaatttattgtattacaaagcttgaaatttacattactagtgcatcatccaattcgt
ccattatatgggtttttccttgatttccaagcagtattattacatccagaacaagtgatt
tatgatgtttccgttgatactttgggtaatctatataatcaagctaaagaatggcttaat
aaatatttcatggttagtgatgtggcgtttttatttacacctccacaaattgcccttgct
gctatgtatgacacagataaaagaataacggagagatacttgaaaagaaagtttttaaaa
gatgaacctaaattggacgctattaaagaggaacaagaacaaccaaagctaaacgaggaa
ccaaaacaagaaggtgaatcaaaagataagtctaatgcacaatcaaatgaaaaacctgat
ggcgaagcacaagtacaaccaaaaataaaatcatcaaacagagaacaatatgaaacgtta
gtgaaatcgataagaagatgtattagaattgcaaagcaatcacaaattgctgatcgtgaa
gcaagtaaagaaattgacaaaaaatgtttctttgcattaaatcctaaaaaattgattgat
aaaaggataaagagactaacgactgctgctacagatggtgctaaagaaacaacagctgaa
cctaaatag

DBGET integrated database retrieval system