KEGG   Candida tropicalis: CTRG_04611Help
Entry
CTRG_04611        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CTRG_04611
Peptidases [BR:ctp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CTRG_04611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 817 aa AA seqDB search
MGDILDQLKYLITNQPHHRQLAPQQSIPNTSTLSLFIPNSLLTYWNTKSYTQKKLLLFQA
TLILSTAFYILLPSLPFYKKKEMFSKRPDKYTTGFINLRNDCFANSSLQAYSSLPSLTEY
LNKFITCFKKLSEFIETHDIDVQKLIDLRLESNKFLQNSKFKRSNSTYDIPLHFAMAAMV
KKLQEIELASRTISVWTFLHELEKIFNAKMSRSQHDAHELTQLINETLENENLKLKSFVK
FLMLNLHKMLKDHPSPKDYNDLENIVVPEFPFDGLILSQMTCLSCNGVSKPNFSPFVILT
LPVPSAPSTKLEKMLDENESEQIEGYQCIKCRVGKIVLNEERMKRDIPSDQESFIKQIFD
LYNSPNLCINEDIPEDLEIFIKNYNVDGIDISRVTSTVQKKSQILKPPKIFGLHLSRSSF
DGQVVTRNSCQVEFNDKMTLSIGSEYHDKLKQFQAMVHEEDEKQMEKLTNKVLTTDVNDM
EDEDVQREDIEERGQEDDEEDDEEDLGDVTDEGTTTENATDELEDDEEDEDDEDSSSLTS
QESVPQTITTSSTIRPSSDSTNGSHEHSINSAPISNKQTDNLKEIFKRFKFNDNDLYKYR
LRAVIKHVGSHTQGHYECFKHKPLFVKDKDGNIFKLSPEIHDDITGETHANAELIDDNSS
SSSSKGTRRRSSVRSNGSNDSDSRFRGRFSSMMGRRPSVFQANPSGVEEIISSGLQTPAE
ILVDDPSLNNFENAFAAHNFKDSFAKTSTVNEEDNAKPEKKVKMKKIPSTITKPYWRISD
AQVTEVTKGAVLSEETTVYMLYYERVDRKQIKRHHRS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatattttggaccaattaaagtatttaattacaaaccaaccacatcatcgtcaa
ctagctccacaacaatccattcctaatacttccactttatcattgttcataccaaattca
ttattaacctattggaacaccaaatcttatactcaaaagaaactattattatttcaagca
actttaatcttatcaacagctttttatatcttattaccttcattgccattttacaagaag
aaagaaatgttctccaaacgtcctgataaatacactacagggtttatcaatttaagaaat
gattgctttgccaactcttcattacaagcatattcttcattgccttcattaactgagtat
ttgaataaattcatcacttgttttaagaaattgctggaatttattgaaactcacgatatc
gatgtacaaaaattgattgatttaagattggaatccaataaatttttacaaaattccaaa
tttaaaagatcgaattcaacttatgatatcccattacattttgctatggctgcaatggtt
aaaaaattacaagaaattgaattagcttcaagaactataagtgtttggacatttcttcat
gaattggaaaaaatttttaatgcaaaaatgtcaagatctcaacatgatgcacatgaatta
actcaattaattaatgaaacattagaaaatgagaatttgaaattgaaaagttttgtcaaa
tttttaatgttaaatttgcataaaatgttgaaagatcatccaagtcctaaagattataat
gatttagaaaacattgttgttcctgaattcccatttgacggtttaattttaagtcaaatg
acttgtttatcttgtaatggagtttcaaaaccaaatttctccccattcgttattcttaca
ttgccagtcccactggctccaagcacaaaattggaaaaaatgttggatgaaaatgaatct
gaacaaattgaaggttaccaatgtattaagtgccgtgtcgggaaaattgtgttgaatgaa
gaacgaatgaaacgtgatatcccatcagatcaagaatcatttattaaacaaatttttgat
ttatataatagtccaaatttatgtattaatgaagatataccagaagatttggaaattttc
attaagaattataatgttgatggtattgatatttccagagtaacatcaacggtacagaaa
aagtcccagattttaaaacctccaaagatttttggtttgcatctttcaagatcttcattt
gatggtcaagtggtgacgagaaattcctgtcaagttgaatttaatgataagatgactttg
tctattggtagtgaatatcatgataaattgaaacaattccaagcaatggttcacgaagaa
gatgagaaacaaatggaaaaattgactaataaagttttaactaccgatgtaaacgatatg
gaagatgaagatgttcaacgtgaagatattgaagaaagaggtcaagaggatgacgaagaa
gatgatgaagaggatttgggtgatgtaactgatgaaggaacgaccactgaaaatgcaacc
gacgagttagaagatgatgaagaagatgaagacgatgaagatagttcctcattgacatct
caggaatctgtaccacaaaccatcaccacatccagcacaataagaccaagcagtgattct
acaaatggatctcatgaacattctattaacctggctccaatatccaataaacaaacagac
aatttgaaggaaattttcaagagatttaaatttaatgataacgatttgtacaagtatcga
ttgcgtgctgttatcaaacatgtgggatcacatactcaagggcattatgaatgtttcaaa
cataaaccattatttgtcaaagataaagatggtaatatttttaaattatctcctgaaatt
catgatgatataactggtgaaacacatgcaaatgccgaattaattgacgataatagtagt
agtagtagtagtaaaggaaccagacgtagatcatctgttcgtagtaatggttcaaatgat
ctggattctagattccgtggaagattttcatcaatgatgggtcgtagaccttcagtattc
caagccaatccttcaggagtcgaagaaattatttcatctggtttacaaaccccagctgaa
atattggttgatgatccaagtttaaataattttgaaaatgcatttgctgctcataatttc
aaagatagctttgccaaaaccagtactgtgaatgaggaggacaatgctaaaccagaaaag
aaggtcaagatgaagaagattccttcaactatcactaaaccatattggagaatcagtgat
gctcaagttactgaagttactaaaggtgcagttttatcagaagaaactactgtttatatg
ttgtattatgaaagagtcgatagaaaacagatcaagcgtcatcatagaagttag

DBGET integrated database retrieval system