KEGG   Candida tropicalis: CTRG_04691Help
Entry
CTRG_04691        CDS       T01115                                 

Definition
similar to histone acetyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CTRG_04691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 417 aa AA seqDB search
MSSEEKSSSNLKVTDVASLRPEQWTSSSNDALKLFVTNKEAAVNFQPTFTYPIFGDAETI
YGYKDLNIFLCFDHFTFKPFLNIKYTEKLNDDPEIIDIKKTIDEYLPNSTIFKDEVKWVD
SIEEEKKNGYKIPGELIDSFELKDKEYEVYKIDLKSEIGYELHQRLQILVLLFIEAGSFI
DAKDELWNLYVFYEKGNSKDNSEPSIVGFTTAYNYWKYPGAEKFDSANHEVRIKISQFII
LPMYQGQGLGQLFYTHLFNKWLKDDSIIEVVIEDPNESFDDLRDRADLKRLNEDPEFDFN
DVTTTVDKNWIEKTRKRLKLEKRQFSRLLEIILLYKLKQGGFPDITKKDVRLFIKKRLYD
KNKEGLATLDDNTKKDKLQTAYQALEEDYYRILGELKLNIKRKSDNDDDLANKKTKT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcggaagagaaatcatcactgaatttaaaagttacagatgtagcatcattaaga
cctgaacaatggacttcatcatcaaatgatgcattgaaattatttgttactaataaagag
gcggcagttaattttcaacccacttttacatatccaatatttggagatgcagaaactatt
tatggatataaagatttaaatattttcttatgttttgatcattttacatttaagccattt
ttaaatattaaatatactgaaaaattaaatgatgatccagaaattattgatattaaaaaa
acaattgatgaatatttaccaaatctgacaatttttaaagatgaagttaaatgggttgat
tcaattgaagaagaaaagaaaaatgggtataaaattcctggagaattaattgattcattt
gaattaaaagataaagaatatgaagtttataaaattgatttgaaatctgaaattggatat
gaattacatcaaagattacaaatcttggtcttattatttattgaagctggttcttttatt
gatgccaaggatgaattatggaacttgtatgttttctatgaaaagggtaatagtaaagat
aattccgaaccatcaattgttggatttactacagcttataattactggaaatatcctggt
gctgaaaaatttgactcagcaaatcatgaagttagaattaaaatttcgcaatttataata
ttaccaatgtatcaaggtcaaggattgggacaattgttttatactcatttatttaataaa
tggttaaaagacgatagtataattgaagttgttattgaagatccaaatgaaagttttgat
gatttgagggatagagcagatttgaaaagattgaatgaagatcctgaatttgattttaat
gatgtaactactacggttgataaaaattggattgaaaaaaccagaaagagattaaaattg
gaaaagagacaattttctagattattagagattattttgttgtataaattgaaacaaggt
ggatttcctgatattacaaagaaagatgttagactatttattaaaaagagattgtatgat
aaaaacaaggaaggtttggctacattagatgataataccaaaaaggataaattacaaaca
gcttatcaagcattagaagaagattattatagaatattgggtgaattgaaattgaatatc
aaacgtaaatccgataacgatgatgatcttgcaaacaagaagacaaaaacctag

DBGET integrated database retrieval system