KEGG   Candida tropicalis: CTRG_04796Help
Entry
CTRG_04796        CDS       T01115                                 

Definition
similar to potential enoyl-CoA hydratase/isomerase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ctp  Candida tropicalis
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ctp01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ctp00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ctp00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ctp00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 506 aa AA seqDB search
MIRLTASSIRPISFTTRSSLALLLSRMSSSVSQNPTASGEEEPVVLTSSKNHARIITLNR
PNKLNSLNTEMIELMTPPVLEYAKSNENNVTIFNFNSPKALCAGGDVAECAIQIRKGNPG
YGADFFDKEYNLNYIISTLPKPYISLMDGITFGGGVGLSVHAPFRVATEKTKLAMPEMDI
GFFPDVGTTFFLPRLDDKIGYYVALTGSVLPGLDAYLAGFATHYIKSERIPSLINRLAGL
QPPEIEGEITVISGNNQYFNQVNDVLNEFSEKNLPQDYKFFLSSDEIAIVNKAFSQDSID
GVFKYLETEGSPFAKKTLDTLSKKPKSSLAVAFALLNAGAKNSIRTQFELEMVSATNIMS
IPAENNDFAKGVIHKLVDKIKNPFFPKWNDPSTVTPEFVKQTLSLSKNTEKYLKRPYLKT
WFGVDFEQYPHSYGVPTNREVAEYIAGTDGSNRTYLPTPSEVFKHFKTKTNNKLGVEVKI
QQILDLHGETAKYDHKYVTWKDEPAK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtttgactgcttcttccataagaccaattagttttactacaagaagttcccta
gcactactattgtcaagaatgtcttcctcggtatctcaaaacccaactgcttctggagaa
gaagaaccagttgtattgacatcttctaaaaaccatgccagaattatcactcttaacaga
cctaataagttgaattctttaaacaccgaaatgattgaacttatgacaccacctgttttg
gaatatgctaaatcaaatgagaataatgttacaatttttaacttcaactcaccaaaagca
ttatgtgctggtggtgatgttgccgaatgtgcaattcaaatcagaaaaggtaacccaggc
tatggtgctgatttctttgataaagaatacaatctcaattatatcatttctactttgcca
aaaccatatatttccctcatggatggtattacttttggaggtggtgttggattatctgtc
catgctccatttagagttgcaactgaaaagaccaagttggcaatgccagaaatggatatt
ggattcttccctgatgttggtactacttttttcttgccaagattggatgacaaaattgga
tattatgttgctttgactggttctgtattgccaggtttagatgcttatttggcaggtttt
gcaacccattacatcaaatctgaaagaattcctctgttgattaatagattggccggtttg
caaccacctgaaattgaaggtgaaattactgttatttctggaaataaccaatactttaac
caggtcaatgatgttttgaatgaattcagtgaaaagaatttgccacaagattacaagttc
ttcctttcatcggatgaaattgcaattgttaataaagcgttctcacaagattcgattgat
ggagttttcaaatatttggaaaccgagggttctccatttgccaaaaagacacttgacact
ttatctaaaaaaccaaagagttcattagctgttgcatttgcattgttgaatgcgggtgcc
aagaactctatcagaactcaatttgaattagaaatggtgtctgctactaatatcatgagt
atcccagctgaaaacaatgattttgccaaaggtgtgattcacaaattagttgacaaaata
aagaacccatttttcccaaaatggaatgatccaagtactgttactcctgagtttgttaaa
caaacacttagtttatctaaaaacactgaaaaatacttgaagagaccatatcttaaaaca
tggtttggtgttgattttgaacaatatcctcatctgtatggtgttccaactaatagagaa
gttgctgaatatattgctggcaccgatggctccaatagaacttatttgccaacaccaagt
gaagtcttcaaacatttcaagaccaagaccaataacaaattgggtgttgaggttaaaatt
caacaaattttggatttacacggcgaaactgcaaagtacgatcataaatatgttacttgg
aaagacgaaccagctaaatag

DBGET integrated database retrieval system