KEGG   Candida tropicalis: CTRG_04916Help
Entry
CTRG_04916        CDS       T01115                                 

Definition
calcium-transporting ATPase 1
Orthology
K01537  
Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     CTRG_04916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 919 aa AA seqDB search
MSDNPYELKPPQLSTQRANNTPSTKYCQQSIEQTAADFQTDIKVGLTNSQDVLNRRSIHG
VNELSSDEEESLVWKFISSFYQDPLILLLIGSAVISVWMGNKDDAISITLAITIVVTVGF
VQEYRSEKSLEALNKLVPAEAKLTRNGSTSAVLASTLVPGDLVHFSQGDRIPADVRLTDA
VHLSIDESNLTGENRPVNKNTDPITAADPAVTERSNIAFMGTLVRDGHGSGIVVATSSQT
VFGTVFEMMSDIEKPKTPLQQAMDKLGKDLSVFSFIVIGIICLIGIFQGRSWLDMFQISV
SLAVAAIPEGLPIIVTVTLALGVLRMARQKAIVRRLPSVETLGSVNVICSDKTGTLTQNH
MTVTKMWTADFKGSFNSPFLVVERLDDNTLHHQLTSNMRKVLECANICNNARYSSENEKY
VGNPSDIALVECLPHFGLEDIRGQRERFYELPFSSSRKYMAVSVHTGDIEKSESFAKGAT
ERILDICDRYYDENGNVKPITEAVADSIHEKSRALASDGLRVLGFAKNNKKFDEKVTTPS
NFIFTGLIGMKDPPRPNVGKSITRLMQGGVHVIMITGDSPTTAMNIAKQIGMPVVGDHSV
MTGDQIDSLTEDALTSAIHDVSVFARTTPEHKVTIVKALQRRGDIVAMTGDGVNDAPALK
LADIGIAMGKNGTDVAKEAADMVLTDDDFSTILSAIEEGKGIFNNIQNFITFQLSTSIAA
LTLIALSTFFGLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRNDEILTA
QVIKRVLQSAIIIILGTMYVFIKEMTDGKITARDTTMTFTCFVLYDMFNALACRHHSRSI
FELGITNQMFNFAVLGSLIGQFCAVYVPFFQSIFQTEALSFSDILHLVILTSSVFIVDEI
RKWYFKRKTIYTNNYTYGV
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataacccttatgaactaaagcctcctcagctatcgacccaacgtgcaaataac
actccatcaacaaaatattgtcaacaatcaattgaacagacagcggcagatttccaaaca
gacatcaaagtaggattgaccaacagtcaagacgtgttgaatagaagatctatccatggt
gtcaatgaattatctagtgatgaagaagaaagtctagtgtggaagtttatatcctcattt
tatcaagatcctttgattttattattgattggttccgcagtgattagtgtttggatgggt
aataaagacgatgccatatccatcactttagctataaccattgttgttactgtggggttt
gttcaagaatatagatcggaaaaatctttggaagccttaaataaattagtccctgctgaa
gcaaaattaactagaaatggaagtacttctgcagtcttggcttctactttggttccaggt
gatttggtccatttttctcaaggggatagaatccctgctgatgtcagattaaccgatgcc
gttcatttaagtattgatgaaagtaacttgactggtgaaaatagaccagtcaacaagaac
actgatccgataactgccgctgacccagcagttactgaaagatccaacattgcatttatg
ggtactttggtcagagatggtcatggtagtggtattgttgttgccacttctagccaaact
gtctttgggactgtttttgaaatgatgagtgatattgaaaaaccaaaaactcctttacaa
caagctatggataaattgggtaaagatttgtcagttttcagttttattgttattgggatc
atttgtcttattggtattttccaaggtcgttcctggttggatatgtttcaaatttctgtg
tccttggctgttgctgctattccagaaggtttgcctattattgttactgtcactttggcc
ttgggagttttgcgtatggctagacaaaaggctattgttagaagattaccaagtgttgaa
actttgggttctgttaatgtcatttgttcagataaaaccggtactttaactcaaaaccat
atgactgttaccaaaatgtggactgctgatttcaagggaagtttcaactccccatttttg
gttgtggaaagattggatgataacactttacatcatcaattgacttcaaacatgcgtaaa
gttttagaatgtgctaatatctgtaacaatgctagatactcatcagaaaatgaaaaatat
gttggtaacccaagtgatattgcccttgttgaatgtttaccacattttggtttagaagat
attagaggtcaacgtgaaagattttacgaacttcctttttcttcttctcgtaaatatatg
gctgtttctgttcatactggtgatattgaaaaatctgaatcttttgccaaaggtgctact
gaaaggattttggacatttgtgatcgttattatgatgaaaatgggaacgttaagcctata
actgaagctgttgccgattccattcatgaaaagtctcgtgccttggctagtgatggtttg
agagtattgggttttgcaaagaacaataaaaaattcgatgaaaaagttactactccaagt
aattttatctttactgggttaattggtatgaaagatcctccaagaccaaatgttggcaag
tccattactagattgatgcaaggtggggttcatgttattatgattactggtgattctcca
accactgcaatgaatattgctaaacaaattggtatgcctgttgttggtgatcattctgtc
atgacaggtgatcaaattgattccttaactgaagatgctcttactagtgctattcatgat
gtttctgtgtttgccagaaccactcctgaacacaaggttaccattgttaaagcgttacaa
agaagaggtgatattgttgccatgactggtgatggtgttaacgatgcaccagcattgaaa
ttggctgatattggtattgcgatgggtaaaaatggtactgatgttgccaaagaagctgct
gatatggttttaactgacgatgatttttctactattcttagtgctattgaagaaggtaaa
ggtattttcaataacattcaaaatttcattacattccaattgagtaccagtatagcggcc
ttgactttgattgctttatctacattttttggattaccaaacccattgaatgctatgcaa
atcttgtggatcaatatcttgatggatggtccaccagctcaatcccttggtgttgaacca
gttgatcatgaagtgatgaaaaagccacctagaaagcgtaatgatgaaattcttactgca
caagtgatcaagagagtattacaatcagctatcataattattcttggtaccatgtatgta
tttattaaagaaatgactgatggtaagattactgcaagagataccaccatgactttcact
tgttttgtgttgtatgatatgttcaatgcattggcatgtcgtcatcattccagactgatt
tttgaattgggtattactaatcaaatgtttaattttgcagttcttggttcattaattggt
caattttgtgctgtttatgtaccatttttccaaagcattttccaaactgaagcattaagt
tttagtgatattttacatttggtcatattaaccagttctgtgtttattgttgatgaaatt
agaaaatggtacttcaagaggaagactatttatactaataattatacatatggagtataa

DBGET integrated database retrieval system