KEGG   Candida tropicalis: CTRG_04975Help
Entry
CTRG_04975        CDS       T01115                                 

Definition
similar to potential catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ctp  Candida tropicalis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CTRG_04975
Enzymes [BR:ctp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CTRG_04975
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CTRG_04975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 252 aa AA seqDB search
MTEELTKEQKFYQYVRDLPEEKLNQIRGNPQAVLQLYDNYPEGFMNIGLYKGEVILKEIK
KKNPEVMIELGGYLGYSAILFGGQLQELNKAAKYYSFEANPDYAKIATHMLELAGVSNVE
IIIGKASFTLPEFRERIFEDKYSPLNFIFIDHWKDLYVPDLRVLESLNLIAPGTVIAADN
IYHPGAPDYVTYVNMSPEEKNIFNQHNKNPEGKQYTGRWNILYKTETIPVTNPKSGFSDA
VEITKCVDFLSG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagagttaaccaaagaacaaaagttctatcaatacgtacgtgatttgcccgag
gaaaaattgaaccaaataaggggcaatccacaagcagtattgcaattatacgacaactac
ccggaaggatttatgaatattggtctttacaaaggtgaggttatacttaaagaaattaaa
aagaagaaccccgaagttatgattgaattaggtggttatttaggatattcagctatttta
tttggaggccaattacaagaattgaacaaggctgcaaagtattattcttttgaagccaac
cctgattatgctaaaattgccactcatatgcttgaattagctggtgttctgaatgtggaa
attatcattggcaaagcttctttcactttacctgagttcagagaacgtatttttgaagac
aagtattccccattgaattttattttcattgatcattggaaagatttatatgtgccggat
ttgagagtattggaatctcttaatttgattgcaccaggaactgtaattgctgctgataat
atctatcatcctggtgctccagattatgttacatatgtcaacatgtcgcctgaagaaaag
aacatatttaaccagcacaataaaaatcccgagggtaagcaatacacgggaagatggaat
attttgtataaaactgaaacaattccagtgaccaacccaaagagtgggttcagtgatgct
gttgaaattaccaaatgtgtagattttttgtcgggctaa

DBGET integrated database retrieval system