KEGG   Candida tropicalis: CTRG_05084Help
Entry
CTRG_05084        CDS       T01115                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp00020  Citrate cycle (TCA cycle)
ctp00620  Pyruvate metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_05084
   00020 Citrate cycle (TCA cycle)
    CTRG_05084
   00620 Pyruvate metabolism
    CTRG_05084
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CTRG_05084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 8299240
NCBI-ProteinID: XP_002550786
UniProt: C5MG91
AA seq 470 aa AA seqDB search
MSALFTVSRSVMATRAIAPKVNTSSFLNLARLYSSGKFPPHTVIHMPALSPTMTQGNIQS
WAKKVGDELAPGEPIAEIETDKASMDFEFQEEGYLAKILMDAGSKEVPVGQPIAVYVEDA
SEVSAFENFTAADAGEAPQGAAPAESEAPKKEEESKSAKESPAAASTSSSAASKQAPTDR
IFASPLAKTIALEKGISLKGVKGSGPHGRITAKDIEGLESKPAAAATTPAAAPAPGATYE
DIPITSMRKTIASRLLQSTQQSPSYIIQSQISVSKLLKLRASLNSTAEDRYKLSINDLLI
KAIARTCVRVPEVNSAWLGEQGVIRQYKNVDVSVAVATPTGLITPIVFNAESKGLADISN
QVKDLGKRAKIGKLAPEEFQGGTICISNLGMNNAVTAFTSIINPPQSAILAIGTTEKKAV
PSEVNEQGFVFDDVITITGTFDHRVIDGALGGEWMKELKRIVENPLELLI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttatttacagtttctagatcagtaatggcaacccgtgccattgctccaaaa
gttaacacttcttcatttttgaacttagctagattgtattcttctggtaagtttccacca
cacactgtcatccacatgccagccttgtccccaaccatgacacaaggtaatattcaatct
tgggctaaaaaggttggtgatgaattagccccaggtgaaccaattgccgaaatcgaaacc
gataaagcctctatggattttgaattccaagaagaaggttatttggctaaaatcttgatg
gatgctggttctaaagaagttccagttggtcaaccaattgctgtctatgttgaagatgcc
agcgaagtttctgcatttgaaaactttactgctgctgatgccggtgaagctccacaaggt
gctgctccagctgaaagcgaagctccaaaaaaagaagaagaatctaaatcagccaaagaa
tcaccagctgctgcttccacatcaagctcagctgcctcaaaacaagccccaactgataga
atttttgcctctccattggctaagaccattgctttggaaaagggtatttctttgaagggt
gttaaaggttcaggtccacacggaagaattactgctaaggacattgaaggtctcgaatct
aagcctgctgctgctgctaccaccccagctgctgctccagctccaggtgctacatacgaa
gacattccaatcacctctatgagaaagaccattgccagcagattgttgcaatccactcaa
caatctccatcttacatcatccaatcccaaatttctgtttctaaattattgaaattgcgt
gcttccttaaactccactgctgaagatagatacaaattgtccatcaacgatttgttgatc
aaggctattgccagaacctgtgttagagttccagaagttaactctgcttggttgggcgaa
caaggtgttatcagacaatataagaatgttgatgtttctgtagctgttgccacaccaact
ggtttaattacaccaattgttttcaatgctgaatctaaaggtttggctgatatttcaaac
caagttaaggacttgggtaagagagccaagatcggaaaattggctccagaagaattccaa
ggtggtaccatttgtatttccaacttgggtatgaacaatgctgttacagccttcacttca
attattaacccaccacaatctgccattcttgctattggtactactgaaaagaaagctgtt
ccaagtgaagtcaatgaacaaggattcgttttcgacgatgtcattactattactggtacc
tttgatcacagagttatcgatggtgctttgggtggtgaatggatgaaggaattgaagaga
attgttgaaaacccattggaattgttgatctaa

DBGET integrated database retrieval system