KEGG   Candida tropicalis: CTRG_05104Help
Entry
CTRG_05104        CDS       T01115                                 

Definition
similar to translation initiation factor subunit eIF3
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ctp  Candida tropicalis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CTRG_05104
Translation factors [BR:ctp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CTRG_05104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 714 aa AA seqDB search
MSINEEDYLQLEKEIKLDDIDFSDLEEKYEVDIGLDNYVIVDGAPVAPEAKVPVLTKVLR
KLFSQAGEIVEGDDGIYMPLEGGKSKGYLFIQFKTPEMADIAIKKLHGKKLDQNHRLLVN
KLSDMEKFGVEGAVSEEFVEPEIEPFQSHGYLKSWLQDEQGRDQAVLHFGESVGVYWNKK
ASEPEPVIEPRKGFTSKYAKFSPKGTYLFSIHPQGVQSWGGDEFKSMKRFFHQQVRLIDF
SPNEKYMVTLSPVPIALPDSTTERAQFPFGPESEGHKLVIWDMLTGEPVRTFALPPHLEG
QKEMPWPLVKWSFDDKYCARQGPDALAIYETPSFQLLEKKLVKIDGIQDFEWAPAGVPLH
NSKATGGEHVLSYWTPESTNQTARVALMQIPSRQILRTVNLFQVSDCKMHWQSNGKLLCV
KVDRHTKSGKTVFSNLEFFKTSERDIPVEKLELKDVVVNFAWEPNSERFITISRLDDGNP
NPAIPKNTISFYAQEVTKGKNASSKYKAYTKIENKHSNTIFWSPKGRYVVVATISRSSGE
LEFYDVSFDDENNKKSNPANVKLLKTEKFAGMTNISWDPSGRFVAAWSSSWLHAIDNGYR
LYEFTGNMLRDDSIDQFKDFVWRPRPESLLTNSDKKKVRSNLREYSAQFEEADAMEADAA
VREAILARRKALEEWRAYRAKHVAKQGVKSNDVQAEIIEEIKEEIIEEKEEIVE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtccattaacgaagaagactaccttcaacttgaaaaggaaatcaagttagatgacatt
gatttttctgatttagaagaaaaatatgaagttgatattggtttagataattatgttatt
gttgatggtgccccagttgctccagaagctaaagttcctgttttaaccaaagttttaaga
aaattattttctcaagcaggtgaaattgttgaaggagatgatggtatttacatgccttta
gaaggtggaaaatcaaaagggtaccttttcattcaattcaaaactccagaaatggctgat
attgctatcaagaaattgcatggtaaaaaattggatcaaaaccatagattgttagttaac
aagttatctgatatggaaaaatttggtgttgaaggtgctgtttctgaagaatttgttgaa
ccagaaattgaaccattccaatctcatggatacttgaaatcttggttacaagatgaacaa
ggaagagatcaagctgttttacattttggtgaaagtgttggtgtttactggaataaaaag
gccagtgaaccagaaccagttattgaaccaagaaaaggtttcacatccaaatatgccaag
ttctctccaaaaggtacttatttgttttccatccatcctcaaggtgttcaatcttggggt
ggtgatgaatttaagagtatgaagagatttttccatcaacaagtcagattgattgatttt
tctccaaatgaaaagtatatggttactttgtcaccagtaccaattgctttgccagattct
acaactgaacgtgcccaattcccattcggtcctgaaagtgaaggtcataaattggttatt
tgggatatgctcactggtgaaccagttagaacttttgcattgccaccacacttggaaggt
caaaaagaaatgccttggccattagttaaatggtcctttgatgataaatactgtgctcgt
caaggtccagatgccttggctatctatgaaactccttcattccaattattggaaaagaaa
ttggttaaaattgatggtattcaagatttcgaatgggctccagctggtgttcctcttcac
aatagtaaagcaactggtggtgaacacgtgttgagttattggactcctgaaagtactaac
caaaccgcaagagttgccttgatgcaaattccatccagacaaattttacgtaccgtcaac
ttgttccaagttagtgattgtaagatgcactggcaatctaatggtaaattgttgtgtgtt
aaagttgatagacatactaaatctggtaagactgttttctctaatttggaattcttcaag
acttctgaaagagatattcctgttgaaaaattggaattgaaggatgttgttgtcaatttt
gcttgggaaccaaattcagaaagattcatcaccatcagtagactcgatgatggtaatcct
aacccagccattcctaagaataccatttcattctacgctcaagaagttaccaaaggtaag
aatgcatcatccaagtataaagcatacacaaagattgaaaacaagcattccaacaccatc
ttctggtctccaaagggaagatatgttgttgttgccaccatctcaagaagttctggtgaa
cttgaattttacgatgtttcattcgatgatgaaaacaacaagaaatctaatccagctaat
gttaaattgttgaagacagaaaaatttgctggtatgaccaatatttcttgggatccatct
ggtagatttgttgctgcatggtcatcatcatggttacatgccattgacaatggttataga
ctttatgaattcactggtaatatgttgagagatgattcaattgatcaattcaaagatttt
gtctggagaccaagacctgaatcattattgaccaacagtgacaagaagaaggtaagatct
aacttgcgtgaatacagtgcccaattcgaagaagccgatgccatggaagctgatgctgct
gtcagagaagccattttggctcgtagaaaagccttggaagaatggagagcttacagagct
aaacacgttgctaaacaaggtgttaaatccaatgatgttcaagccgaaataattgaagaa
attaaagaagaaattattgaagaaaaagaagaaattgttgaataa

DBGET integrated database retrieval system