KEGG   Candida tropicalis: CTRG_05145Help
Entry
CTRG_05145        CDS       T01115                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ctp  Candida tropicalis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ctp00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ctp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 980 aa AA seqDB search
MSQSLAHPIEERRNSIDSAGELSPSELHYSSCDSPPHPGSILRKSSSSPIQSDLPNIYSN
LRAIDTEPPTKSSHGRNILKKLLRINGSSDSIGDQPAASTPSTNGTTTSTPTSSSSSSSS
KGLKRGKSIQRSKALQHTDSDVEYFGEQVDLHPDISKSIGHIKISPTFSNEGLPLLKVSH
KSKKRILFYIDPTSFKFTWRVATGSNIGSASSPNTPMTASLSSNSAGTNGSGSNASGGTH
RLSISAGRSLHEFNIDDIKSVYKQKHGSSYREELRISQEFENKWITIIYFNHKKGTLKSL
HLIADSEHDFKKLNTAVQNLRNLRFELAKEFLIDLNNLNENYMKVILNEELQSQQHSKQI
REFLSFNDILKYVKRLNINVNTNHLRQIFDQASQSGGDGTFEHGLNFDQFKRFVFILKER
KDVQSIVEDKSHGKKYMSYDDVKKFIKHTQKDDFDSESIQQIYDKFCNEDGVWTAESLND
FLMSSYSKPYRNFESKHYYEHPLNEYYISSSHNTYLTGRQVVGESSVDGYIRALQRGCKC
VEIDIWNGDDPNESEPVVNHGRTFTKSIGLTNVIRTIKKFAFITSPFPVILSLEIHCSGP
SQLKVVAILKDILKEDLILAPIDDMPVLPSPNDLQHKFIVKVKKTTAFENLIEMDNGSFT
STTSTSTSTSTSQSEDNGTNSSSKSTSIILRRKNKTPKVINELSDLGVYAQGLKFRNFSL
PESKTYNHCFSLGEKTINRILKDESTKNQLLKHNRKFLMRVYPGGTRINSTNYSPLPYWG
VGCQLVATNWQTMDQGQLLNLAMFSSNSNKGYILKSSSLRRPILSSKLPTFIQSKLTKSK
FNFEIISAHQLPKPKTKEDTTPPNIFITFEIIGADDINWKSSSIPKTTKIVAQNGFNPIF
NAKFNGVMTLQNDLVFMKLVVYATTSALNPDLGESTPIGISVVKIDHLKKGYRCLPIYDL
LGEQLLYSSLFMYIDYEDFQ
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaagtttggctcatccaattgaagaacgacgtaattcaatcgatagtgcggga
gagctcagtccatctgaactacattattcatcttgtgatctgcccccacatcctggttca
attctacgaaaatcatcatcatctcctatacagtcagatctaccaaatatttatagtaat
cttcgagctattgatactgagccacctaccaaatcaagtcatggacgcaatattctaaag
aaattactacgaataaacggatcttctgatagcatcggtgatcagcctgcggcatctact
ccctcgacaaatggaaccacaacatcaacaccaacatcatcgtcgtcgtcatcttcgtca
aagggtttaaaacgaggtaaaagtattcaaagaagtaaggcattacagcatactgattct
gatgtggagtactttggggaacaggttgacctacatccagatatatccaaatctataggt
catatcaagatttcgcctacctttagcaatgaaggtttacctttacttaaagtttctcac
aaatcaaagaaaagaattcttttttacatcgaccctaccagctttaaattcacctggagg
gttgcaactggatctaatattggaagtgcatccagcccaaatacacccatgacggcttcc
ctttcatcaaattcagctggtacaaacggtagtggtagtaatgctagtggtggtactcat
agattgtctatatctgctggacgctcactacatgagttcaatattgatgacattaagtct
gtttacaaacaaaagcatggcagttcttaccgagaagaattgcgtatctcacaagagttt
gaaaataaatggataactattatttattttaatcacaagaaagggactttgaaatcacta
catttaattgcggattctgaacatgacttcaagaaactaaatacggctgtgcagaattta
agaaatttaaggtttgagttggcaaaggaatttttaattgatttgaataatcttaatgaa
aattatatgaaagtgatactaaatgaagagcttcaaagtcagcagcatagtaaacaaata
agagaatttctttcatttaatgatattcttaagtatgtcaaaagattaaatatcaatgtc
aacaccaatcatttgagacagatttttgaccaagcatcccagagcggtggtgatggtact
tttgaacatgggttgaattttgatcaattcaagcggtttgtgttcatattaaaggagaga
aaggatgtccaaagcattgttgaagataaaagtcatgggaagaaatacatgagttatgat
gatgtaaagaagtttatcaaacacacacagaaagatgactttgatagcgaatctatacaa
cagatttatgacaagttttgcaatgaagacggtgtctggaccgctgaaagtttaaacgat
tttcttatgtcaagttattctaaaccataccgtaattttgaatcaaagcattactatgaa
catccgttgaacgaatattacatttcatcatcacataacacgtatttaactggtcggcaa
gttgttggagaatcgtcagttgacgggtatattcgtgcattgcaacgtggatgtaaatgt
gtcgagatagatatttggaatggtgatgatcccaatgagtctgaaccggtggtcaatcat
gggagaacttttaccaagtcaattggattgactaacgttattagaacaataaagaaattt
gcatttataacttctcccttcccagtcattttaagtttggaaattcactgttcgggacca
agtcaattgaaagtagttgcaatcttgaaggacattctaaaagaggatttgattcttgct
ccaattgatgacatgccagtcttgccatcacctaatgatttacaacacaagttcattgtg
aaagtaaagaaaacaactgcatttgagaatttaattgaaatggataatggaagtttcact
tccactacaagtacatcaacatctacttccacttcccaaagtgaagacaacggaacaaac
agttcttctaaatccacgtcgataatactccgaagaaagaacaaaacacccaaagtaatc
aacgaattaagtgatttaggtgtttatgcccagggtttgaaatttagaaacttttctttg
ccggaatccaaaacgtacaaccattgtttttcattaggtgaaaagactatcaatagaatt
ctcaaggacgaatctaccaagaatcagttattaaagcacaatagaaagtttttgatgcgt
gtttatcctggtggcacaagaataaattcaacgaattatctgccacttccatattgggga
gtaggatgtcaattggttgccacaaattggcagactatggatcaaggacaattgctaaat
ttggctatgttttcatcgaattctaataaaggttatattttgaaatctagttcccttaga
agaccaatattatcatcaaaacttccaacattcattcaatcaaaattaacaaaatcaaag
ttcaattttgaaatcataagtgcacatcaattacctaaacctaagacaaaagaagataca
acaccgccaaatatttttataacgtttgaaataattggtgctgatgatattaattggaaa
agttcaagtattcctaaaactacaaaaatagttgcccaaaatggtttcaatccaattttt
aatgcaaaattcaatggtgttatgacacttcaaaatgatttagtatttatgaaattagta
gtttatgcgactacatcagcattaaatcctgatcttggtgaactgactccaattggtatt
tcagtagttaaaattgatcatcttaaaaaaggttatcgttgccttccaatttatgattta
ttaggtgaacaattgctttattcttcactttttatgtatatagattatgaagattttcaa
tag

DBGET integrated database retrieval system