KEGG   Candida tropicalis: CTRG_05150Help
Entry
CTRG_05150        CDS       T01115                                 

Definition
similar to pyrazinamidase/nicotinamidase
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
ctp  Candida tropicalis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CTRG_05150
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CTRG_05150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 231 aa AA seqDB search
MTKLALVVVDLQEDFLPPDGSLAIKDGRSIVPDINKLLIDPKYKWSLVIATQDWHPANHI
SFASQHNVDPYTELTFKHPKGEIDPTTNEVKTMKQFVWPDHCVQNSKGASLEPTFEKSFG
SVPTPSANVKKGYLEDREYYSCFQDCWGLHHTEILDLLKKDEITDVVFVGLAYDFCVLNS
AIDCAKNGFNTFVFKQYTKSVYPDKEKDTDQLYADNGVKIIEDVSQFVTNP
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattagcattggtagttgttgacttacaagaagatttccttccacctgatgga
tcattagcaattaaagatggtcgttcaattgttccagatatcaataaattattaattgat
ccaaaatataaatggtcgttggttatagctactcaagattggcatccagcaaatcatatt
tcatttgcgtctcaacataatgtggatccatatactgaattgacgttcaaacaccctaaa
ggagagattgatccaactacaaatgaagtgaaaactatgaagcagtttgtttggcctgat
cattgtgttcagaattcaaagggggcaagtcttgaacctacttttgagaaatcctttggg
tcagttcctacacctctggcaaatgtgaaaaaggggtatttggaagatcgagaatattat
tcatgtttccaagattgttggggcttacaccatactgagattttagatttattgaaaaaa
gatgagattacagatgttgtatttgttggtttagcttacgatttctgtgtattgaattct
gctattgattgtgcaaaaaatgggtttaatacatttgttttcaaacaatacaccaaaagt
gtttatcctgataaggaaaaggatactgatcagctatacgcagacaatggggtaaagata
attgaagatgtatcacagtttgttactaatccctag

DBGET integrated database retrieval system