KEGG   Candida tropicalis: CTRG_05206Help
Entry
CTRG_05206        CDS       T01115                                 

Definition
similar to protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ctp  Candida tropicalis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CTRG_05206
Enzymes [BR:ctp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CTRG_05206
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CTRG_05206
  Exosomal proteins of colorectal cancer cells
   CTRG_05206
  Exosomal proteins of bladder cancer cells
   CTRG_05206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 552 aa AA seqDB search
MKFWKYSTNALATLLAIVSLTNAGGPADGDAVADPNSAVVKLTSENFAAFIEENPLVLTE
FFAPWCGYCKMLGPEFSKAADSLNESHPKIKLAQIDCTEDEALCMEHGIRGYPTLKIIRD
GDNKAAEDYQGPREADGIVDYMIKQSLPPVSTPESSEDLIALIEEQTKPFVLQINPTAEG
NTTFYKVANQKRKDYLFVSVEDKSIIKDLSKKFKTVDITGKKPSYLVVQPNQFDDAAKFD
NKNTLDADSLIEFIGVEAVPYFGEINQQTYMTYMSSPLPIAYYFYNTADQRAEVEDSLTK
LGKKYRGKLNIVGLDASMFGRHAEVINMDPEIVPLFAIHHIGDNKKYGVNQTDYPEGPST
DVIEKFVDDYFEGKLSPIIKSEPLPTEEEKKTNPVVKLVAHNYKEIMDQTDKDVFVKYYA
PWCGHCKKLAPTWEELAEIFGSNKEDANVIVADIDHTNNDVDVPYNIEGYPTLLMFPANG
KIDEKTGLREPIVFEGARELDSLISFIKEKGALGVDGVELKAKLEEAKEAADGEEAKEVE
EEEEEDVEHDEL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctggaaatattctaccaatgctttagctactttgttagccattgtttcttta
accaatgctggaggtccagctgatggtgacgccgttgctgatccaaacagtgctgttgtc
aaattgacttcagaaaactttgctgcattcattgaagaaaatccattggttttaaccgaa
ttctttgccccatggtgtggatactgtaaaatgttgggaccagaattttccaaagctgct
gatagtttgaatgaatcccatccaaagatcaaattggcccaaattgattgtactgaagat
gaagcattatgtatggaacatggtatcagaggttacccaaccttgaagatcatcagagat
ggtgacaacaaggctgctgaagattaccaaggtccaagagaagctgatggtattgttgat
tacatgattaaacaatccttgccaccggtttctactccagaatcatctgaagatttaatt
gccttgattgaagaacaaaccaaaccatttgttttacaaatcaacccaactgctgaaggt
aacactactttctacaaagttgctaaccaaaagagaaaagattatctttttgtttctgtt
gaagacaagagtatcatcaaggatttgagcaagaaattcaagactgttgatatcactggt
aagaaaccaagttacttggttgtccaaccaaaccaattcgatgatgccgccaaatttgat
aacaaaaataccttggatgctgattcattgattgaatttattggtgttgaagctgttcca
tactttggtgaaattaaccaacaaacttacatgacctatatgtcttctccattaccaatt
gcctactacttctacaacacagctgatcaaagagctgaagttgaagattctttgactaaa
ttgggtaagaaatacagaggtaaattgaacattgttggtttagatgctagtatgtttggt
agacatgctgaagtcatcaacatggacccagaaattgttccattgtttgctatccaccac
attggtgacaacaagaaatacggtgttaaccaaaccgattacccagaaggtccatccact
gatgtcattgaaaagtttgtcgatgactattttgaaggaaaattgagcccaatcattaaa
tctgaaccattgccaactgaagaagaaaagaagaccaacccagttgttaaattggttgct
cacaactataaagaaattatggatcaaactgataaggatgttttcgttaaatactatgct
ccatggtgtggccactgtaaaaaattggccccaacctgggaagaattagctgaaattttc
ggttctaacaaggaagatgctaatgttattgttgctgatattgatcacaccaacaatgat
gttgatgttccatacaatatcgaaggttatccaaccttgttgatgttcccagccaacggt
aaaattgatgaaaagactggtttgagagaaccaattgttttcgaaggtgccagagaattg
gatagtttgatttctttcatcaaagaaaaaggcgctttgggtgttgacggtgttgaatta
aaggctaaattagaagaagccaaagaagctgctgatggagaagaagccaaagaagttgaa
gaagaagaagaagaagatgttgaacacgatgaattgtaa

DBGET integrated database retrieval system