KEGG   Candida tropicalis: CTRG_05212Help
Entry
CTRG_05212        CDS       T01115                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ctp  Candida tropicalis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTRG_05212
   00670 One carbon pool by folate
    CTRG_05212
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CTRG_05212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 194 aa AA seqDB search
MQSKPVISIIVAALKPSLGIGNNGKMPWRLRKEIRYFKDVTSKTTVENSRNAVIMGRKTW
ESIPVKFRPLPDRLNIILSRSYENEIIDENIIHANSVESSLSFMSNIDRVFIIGGAEIYN
DLINNPLVTQLLITEIEHSNPESVEMDTFLKFPLEKWTKQPKSELQKFIGDEITLEDNIN
EGDFTYNYTLWTRK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaaaaccggttatatctattattgttgctgctttgaaaccatctcttggtatt
ggaaacaatgggaagatgccatggagactccgtaaagagattagatatttcaaggatgtt
acatcgaaaacaacggttgaaaattctcgaaacgctgtgattatgggtagaaaaacttgg
gaatcaattcccgttaaatttagaccccttcctgatagattaaatattattttgtcaaga
tcttatgagaacgaaatcattgacgagaacattatccatgccaattcagtagaatcttca
ttatcttttatgtcaaacatcgatcgagtatttattattggaggtgctgaaatttacaac
gatttgattaacaacccattggtgacccaattattgatcactgaaatagaacactctaac
cctgaatcagttgaaatggacacatttttgaaattccccttggaaaaatggaccaaacaa
ccaaaatcagaattacaaaaatttatcggtgatgaaatcacactagaagataatataaat
gaaggtgactttacttataattacacactatggacaagaaaataa

DBGET integrated database retrieval system