KEGG   Candida tropicalis: CTRG_05355Help
Entry
CTRG_05355        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
ctp  Candida tropicalis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTRG_05355
Enzymes [BR:ctp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CTRG_05355
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CTRG_05355
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     CTRG_05355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 793 aa AA seqDB search
MYNKDTVFTKDIACTAITGKDAWNRPTPQPITISLNFNTDFHKASQLDNLKYSINYAVIT
RNVTEFMKSNEHLNFKSLGNIAQAVGDIGLNESRGGGSSVEVTIKSTKSEIRADSVEYKI
LRNNLGITPPLDVFRVNKLRLLTIIGVFTFERLQKQIVDVDLEFKIKDNSNLFFHKIIED
IVNYVESSNFKTVEALVSKIGQLTFQKYGSGIEEVLAIVTKPNAFSHVEGVGVSSTMTLD
NFKDMEPIEYENAAKAVTSFNLPVEQEKTDKYEGYHTAYIAFGSNSGDQMLNINDALKLL
SNYDIIVESTSSLYISKPMYYLDQPDFFNGAIKINFMDISPHRLLEILKEIEYSHLKRVK
EFDNGPRSIDLDIILYDDLTLNTEDLIIPHKSLLERTFVLQPLCEILPPDFIHPISAESI
HSHLKQLLNEKPQEDETLQVSSDLLQFVPVPRLSLSPADNILRFDHINKKSPTLIMAILN
MTPDSFSDAGKYYDQALEDIVKNAERLVAEGANIIDIGGVSTRPGSTEPSEEEELQRVVP
LVKAIRESKNPALRNVLISIDTYRSNVAEESLIAGADIINDISMGKYDDMMFDVIALYGC
PYIMNHTRGTPKTMSKLTSYESNTNDDLVEFVIDPKLGQQGDLEVSTDSKNLLNGVSREL
SLQMFKAMAKGVKKWQIIVDPGVGFAKNLQQNLDIIRHASFFKKYSIQLNERVGDEIRHN
YLSFNGMPLLVGTSRKKFLGTLTGKETNPSDRVLATAATVTASIEQNTDIVRVHDVKEMK
DVVLTSDAIYRSI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtataataaagatacggttttcactaaagatatagcatgtacggccattaccgggaaa
gatgcctggaatagaccaactccacagccaataaccatatcgttaaatttcaacactgat
tttcataaagcatcccagcttgacaatttgaagtattcgattaattatgcagttattacc
agaaatgtcaccgaatttatgaaatcaaatgagcatttaaatttcaaatctttgggtaat
atcgcccaagccgtcggtgatattggtttgaatgaaagtagaggtggtggctcatctgtg
gaagttaccataaagagtaccaaatctgaaattagagctgatagtgtggaatacaaaatt
ttgagaaataacttgggaatcacccctccattagatgttttcagagttaacaagttgaga
ttgttgactattattggtgttttcacttttgaaagattacagaaacaaatcgttgatgtt
gatttagaatttaaaatcaaagacaattctaatttgtttttccataaaatcattgaggat
attgtcaactacgtagaatcatcaaacttcaaaaccgttgaagcgttggtttccaaaata
ggtcaattgacttttcaaaagtatggttctggtattgaagaggttttagcaattgtgacc
aaaccaaatgcatttagccacgtcgaaggtgtgggtgtttcatcaacaatgactttggac
aattttaaagacatggaaccaattgaatatgaaaatgctgcgaaggcagttacatcattc
aatttaccagttgaacaagaaaaaacagataaatatgaaggctaccacacagcatacatt
gcatttggatcaaactctggtgaccaaatgttaaacatcaatgatgcacttaagttattg
ctgaattatgatatcattgttgaatctacctcctcgttgtacatttcaaaaccaatgtat
tatttggatcagccagatttcttcaatggtgccatcaaaatcaattttatggatatttca
cctcatcgattgttggagattcttaaagaaattgaatattcccatttaaagagagtcaaa
gagtttgataacggacctagatctatcgatttagatattattttatacgatgatcttaca
ttgaatacagaagatttaatcattcctcataaatcattgcttgaaagaacatttgtgttg
caaccattgtgcgagatcttaccaccagattttattcatcctatcagtgcagaaagtatc
cacagccatttgaaacaattgttgaatgaaaaaccacaggaagatgaaacattgcaagta
tcttctgatttgttgcagttcgtacctgttccaagattatcgttatcaccagctgataac
atcttaagatttgatcacattaataaaaaatcacctactttaattatggctattttgaat
atgactccagattcgtttagtgatgccggtaagtattatgaccaagctttagaggatatt
gtcaaaaatgccgagagattggttgccgaaggagctaatattattgacattggaggtgtt
tccacaagaccaggaagtactgaacctagcgaagaagaagaattgcaaagggttgtacct
ttggttaaagcgatccgtgaatctaagaatcctgcattgagaaatgttttaatttctatt
gatacatatcgtagtaatgttgcagaagaaagtttaattgcaggtgctgatattattaat
gatatttctatgggtaaatatgacgacatgatgtttgatgtcattgcattatacggatgt
ccttatatcatgaatcacaccaggggaactccaaagactatgtccaagttgactagttat
gaatcaaacactaatgatgatttagtagaatttgttattgatcctaaattgggacaacaa
ggtgatctcgaagtttcgacagattcaaagaacttactcaatggagtcagtcgagaatta
agtttgcaaatgttcaaagccatggctaaaggggttaaaaaatggcagatcattgttgat
cctggtgttggatttgcaaaaaatttgcaacaaaacttggatattatccgtcacgcatca
ttcttcaagaaatactcaatccagcttaatgaaagggttggagatgaaataagacataat
tatttaagctttaatggtatgccactattggttggaacatcaagaaagaagttccttgga
actttgaccggtaaagaaaccaatccactggatagagttcttgccactgctgctactgtt
actgcaagtatagagcaaaatacggatattgttagagttcatgatgttaaagaaatgaaa
gatgttgttctaacaagcgatgctatatataggtctatctag

DBGET integrated database retrieval system