KEGG   Candida tropicalis: CTRG_05375Help
Entry
CTRG_05375        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_05375
Enzymes [BR:ctp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CTRG_05375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 299 aa AA seqDB search
MPVEELEDRVIITDPSDSSNSVTILKFGANIISWKNNNVEKLWLSDAAKLDGSKAVRGGI
PLVFPVFGKQKDSNHPTFKLPQHGFARNSTWEFLGQTTENPISVQFGLGPENVDPETLKL
WNFDFTLLLTITLSKDKLITTIDVENTGKESFDFNWLFHTYYRIDDITDSLVNNLAEQTC
FDQLVGESYIEKAPIISFHEEFDRIYSNVSTEKTLQIVDKGKVLFNVDRKNLPDAVVWNP
WTKKAEGMADFEPKSGFHQMLCVEPGHVATMISLPPGDKWSGAQEITLGGEIKVQAKIY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcgaagaacttgaagatcgtgtcatcatcactgatccatctgattcatccaat
tcagtaactattttgaaatttggtgctaatattatttcatggaagaataataatgttgaa
aaattatggttatcagatgctgctaaattagatggtagtaaagccgttagaggtggtatt
ccattagttttcccagtttttggtaaacaaaaagattcaaatcatccaacttttaaatta
ccacaacatggttttgctcgtaattcaacttgggaatttttgggtcaaactactgaaaat
ccaattagtgttcaatttggtttaggtcctgaaaatgttgatccagaaactttaaaatta
tggaattttgatttcactttattattaactattactttatctaaagataaattaattaca
actattgatgttgaaaatactggtaaagaatcatttgatttcaattggttattccatact
tattatagaattgatgatattactgattctttagttaataatttggctgaacaaacttgt
tttgatcaattggttggcgaatcttatattgaaaaggctccaattattagtttccatgaa
gaatttgatagaatttattcaaatgtaagtactgaaaaaactttacaaattgttgataaa
ggtaaagttttatttaatgttgatagaaaaaatttacctgatgctgttgtttggaatcct
tggactaaaaaagctgaaggtatggctgattttgaaccaaaatccggatttcatcaaatg
ttatgtgttgaacctggtcatgtcgctacaatgatttctttacctccaggtgataaatgg
tcaggtgctcaagaaattactcttggtggtgaaattaaagttcaagctaagatttattag

DBGET integrated database retrieval system