KEGG   Candida tropicalis: CTRG_05482Help
Entry
CTRG_05482        CDS       T01115                                 

Definition
alcohol dehydrogenase 2
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CTRG_05482
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_05482
  Lipid metabolism
   00071 Fatty acid degradation
    CTRG_05482
  Amino acid metabolism
   00350 Tyrosine metabolism
    CTRG_05482
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CTRG_05482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 348 aa AA seqDB search
MSIPTTQKAVIFETNGGKLEYKDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLDTK
LPLVGGHEGAGVVVAMGDNVKGWKVGDFAGIKWLNGSCMNCEYCQQGAEPNCAEADLSGY
THDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVYKALKTADLQPGQWVAISGAA
GGLGSLAVQYAKAMGYRVVAIDGGDDKGEFVKSLGAEVFIDFLKDKDIVAAVKKATDGGP
HGAINVSISEKAINQSVDYVRTLGKVVLVGLPAGSKVSAPVFDSVVKSIQIKGSYVGNRK
DTAEAVDFFSRGLIKCPIKIVGLSELPEVYKLMEEGKILGRYVLDNSK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctattccaactactcaaaaagctgttatctttgaaaccaacggtggtaaattagaa
tacaaagatattccagttccaaagccaaaaccaaatgaattgttaatcaatgttaaatac
tctggtgtttgtcacactgatttacacgcctggaaaggtgattggccattggacaccaaa
ttaccattggttggtggtcatgaaggtgctggtgttgttgttgccatgggtgacaatgtt
aaaggttggaaagttggtgattttgctggtattaaatggttgaatggttcttgtatgaat
tgtgaatattgtcaacaaggtgctgaaccaaattgtgctgaagctgatttgtctggttac
acccatgatggttctttccaacaatatgctactgctgatgctgttcaagctgctagaatt
ccagctggtactgatttagctaatgttgctccaattttatgtgctggtgtcactgtttat
aaagctttgaaaaccgctgatttacaaccaggtcaatgggttgctatttctggtgccgct
ggtggtttgggttctttggctgttcaatacgctaaagccatgggttacagagttgttgcc
attgatggtggtgatgataaaggtgaatttgttaaatctttgggtgctgaagttttcatt
gatttccttaaagataaagatattgttgctgctgttaaaaaggctactgatggtggtcca
catggtgctatcaatgtttctatctctgaaaaagccattaatcaatctgttgattacgtt
agaactttaggtaaagttgttttggtcgggttaccagctggatctaaagtttctgctcca
gtctttgattctgttgttaaatctatccaaatcaaaggttcttatgtcggtaacagaaaa
gataccgctgaagctgttgatttcttctcaagaggtttgatcaaatgtccaatcaagatt
gttggtttgagtgaattaccagaagtctacaaattgatggaagaaggtaagatcttgggt
agatacgtcttggacaattctaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system