KEGG   Candida tropicalis: CTRG_05518Help
Entry
CTRG_05518        CDS       T01115                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ctp  Candida tropicalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTRG_05518
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTRG_05518
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CTRG_05518
Enzymes [BR:ctp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CTRG_05518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 503 aa AA seqDB search
MSSQVYRSTRSSKPEELSFEDVVMTGLAPDGGLYLPSAIPQLPSDFLTKWADLSFNELAF
EILRLYINQSEIPDEDLKSLISRSYSTFRSSEVTPLKKIDDNLYILELFHGPTYAFKDVA
LQFVGNLFEYFLTRRNAAKKENEPKDIITVVGATSGDTGSAAIYGLRGKKDVSVFILYPT
GRISPIQEEQMTTVEDANVHTLSVNGTFDDCQDIVKQIFGDKEFNDKYHVGAVNSINWAR
ILAQQTYYFYSYFQLKKQTKNDKVRFVVPSGNFGDILAGYYAYRMGLPVDKLIIATNEND
ILDRFIKSGEYAKEQETGVKSTYSPAMDILISSNFERLLWYLVRDNSTHNDEKAGEVLNG
WMQDLKQQGKFKVPQEVIEGARKIFDSQRVDNETTVETIKQVYGKTSDKYVIDPHTAVGV
NTSYTFIKQDNEPVEYISLSTAHPAKFSEVVNKALSSFDGYSFEKDVLPAELKALSTKEK
RIKLIDEASVPKVKQAISDILQF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcaagtgtatagatctactcgttcttctaaaccagaagaattatcctttgaa
gatgtcgttatgactggtttggccccagatggcggtttatatttaccatcagctatccca
caattaccaagtgattttttaaccaaatgggccgatttatcatttaatgaattagctttt
gaaatcttgagattatacattaaccaatcagaaattccagatgaagatttgaaaagtttg
atttctagatcttactccacttttagatcatctgaagttactcctttaaagaaaatcgat
gataatttgtacattttggaattattccatggtccaacttatgcattcaaagatgttgct
ttacaatttgttggtaatctttttgaatatttcttaactagacgtaatgctgccaaaaag
gaaaatgaaccaaaagatatcatcactgttgttggtgctacttctggtgatactggatct
gcagcaatttatggtttaagaggtaagaaagatgtttctgtctttattttatatccaact
ggtagaatcagtcctattcaagaagaacaaatgactactgttgaagatgccaatgtccat
actttatctgtcaatggtacttttgatgactgtcaagatattgttaaacaaatctttggt
gacaaagaatttaatgataaataccatgtcggtgctgtcaactctatcaactgggcaaga
atcttggctcaacaaacttattatttctattcctatttccaattgaaaaaacaaaccaag
aatgataaggttagatttgttgttccatcaggtaatttcggtgatattttggctggttat
tatgcttatagaatgggattaccagttgataaattaatcattgccactaatgaaaacgat
atcttggatagatttattaaatctggtgaatatgccaaagaacaagaaactggtgttaaa
tccacttattctccagctatggatattttaatttcttcaaattttgaaagattattatgg
tatttggttagagacaattctactcataatgatgaaaaagctggtgaagtattgaatggt
tggatgcaagatttgaaacaacaaggtaaattcaaagttcctcaagaagttattgaaggt
gccagaaagatttttgattctcaaagagttgataatgaaaccactgttgaaaccatcaaa
caagtttatggtaaaacttctgataaatatgttattgatcctcatactgctgttggtgtc
aacacttcttacactttcatcaaacaagacaatgaaccagtagagtacatctccctttcc
actgctcatcctgctaaattctccgaagttgttaacaaagcccttagttcattcgatgga
tactcatttgaaaaagatgttttaccagctgaattgaaagctttgagtactaaagaaaag
agaatcaagttgattgatgaagccagtgttccaaaggttaaacaagctatcagtgatatc
ttacaattttaa

DBGET integrated database retrieval system