KEGG   Candida tropicalis: CTRG_05608Help
Entry
CTRG_05608        CDS       T01115                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTRG_05608
   01230 Biosynthesis of amino acids
    CTRG_05608
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_05608
   00051 Fructose and mannose metabolism
    CTRG_05608
   00562 Inositol phosphate metabolism
    CTRG_05608
Enzymes [BR:ctp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTRG_05608
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTRG_05608
  Exosomal proteins of bladder cancer cells
   CTRG_05608
  Exosomal proteins of melanoma cells
   CTRG_05608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 248 aa AA seqDB search
MARQFFVGGNFKANGTKQQITDIIENLNSADLPKNVDVVVFPPSVYLGLTVSLNKQPTIS
VGAQNVFDKACGAFTGETCASQLIDVGAKWTLTGHSERRTILGESDEFIAQKTKFALDNG
VGVVLCIGETLEERKSGVTLDVCARQLDAVSKIVSDWTNIVVAYEPVWAIGTGLAATPED
AEETHKGIREHLAKTIGAEQAEKTRILYGGSANGKNAPTFKDKANVDGFLVGGASLKPEF
VDIIKSRQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaattcttcgtcggaggtaacttcaaagctaacggtaccaaacaacaaatc
actgatatcattgaaaacttgaacagtgctgatttaccaaaaaacgttgatgttgttgtc
ttcccaccatctgtctacttgggtttgactgtctccttgaacaaacaaccaactatttct
gttggtgctcaaaatgtctttgacaaagcttgtggtgctttcactggtgaaacttgtgcc
tcccaacttattgatgttggtgctaaatggactttgactggtcacagtgaaagaagaacc
atccttggtgaatccgatgaattcattgctcaaaagactaaatttgccttagacaacggt
gttggtgttgttttatgtattggtgaaactttggaagaaagaaaatccggtgtcacttta
gatgtctgtgctagacaattggatgctgtttccaagattgtctctgactggaccaacatt
gttgttgcttacgaaccagtctgggctatcggtaccggtttggctgctactccagaagat
gctgaagaaacccacaaaggtatcagagaacatttggccaagaccattggtgctgaacaa
gctgaaaagaccagaatcttgtacggtggttctgccaacggtaagaatgccccaaccttc
aaagacaaagccaatgttgatggtttcttagtcggtggtgcttcattgaaaccagaattc
gttgacattatcaaatccagacaataa

DBGET integrated database retrieval system