KEGG   Candida tropicalis: CTRG_05608Help
Entry
CTRG_05608        CDS       T01115                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp00051  Fructose and mannose metabolism
ctp00562  Inositol phosphate metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
ctp01230  Biosynthesis of amino acids
Module
ctp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ctp_M00002  Glycolysis, core module involving three-carbon compounds
ctp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_05608
   00051 Fructose and mannose metabolism
    CTRG_05608
   00562 Inositol phosphate metabolism
    CTRG_05608
Enzymes [BR:ctp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTRG_05608
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTRG_05608
  Exosomal proteins of bladder cancer cells
   CTRG_05608
  Exosomal proteins of melanoma cells
   CTRG_05608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 8300821
NCBI-ProteinID: XP_002551310
UniProt: C5MHR5
Position
Unknown
AA seq 248 aa AA seqDB search
MARQFFVGGNFKANGTKQQITDIIENLNSADLPKNVDVVVFPPSVYLGLTVSLNKQPTIS
VGAQNVFDKACGAFTGETCASQLIDVGAKWTLTGHSERRTILGESDEFIAQKTKFALDNG
VGVVLCIGETLEERKSGVTLDVCARQLDAVSKIVSDWTNIVVAYEPVWAIGTGLAATPED
AEETHKGIREHLAKTIGAEQAEKTRILYGGSANGKNAPTFKDKANVDGFLVGGASLKPEF
VDIIKSRQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaattcttcgtcggaggtaacttcaaagctaacggtaccaaacaacaaatc
actgatatcattgaaaacttgaacagtgctgatttaccaaaaaacgttgatgttgttgtc
ttcccaccatctgtctacttgggtttgactgtctccttgaacaaacaaccaactatttct
gttggtgctcaaaatgtctttgacaaagcttgtggtgctttcactggtgaaacttgtgcc
tcccaacttattgatgttggtgctaaatggactttgactggtcacagtgaaagaagaacc
atccttggtgaatccgatgaattcattgctcaaaagactaaatttgccttagacaacggt
gttggtgttgttttatgtattggtgaaactttggaagaaagaaaatccggtgtcacttta
gatgtctgtgctagacaattggatgctgtttccaagattgtctctgactggaccaacatt
gttgttgcttacgaaccagtctgggctatcggtaccggtttggctgctactccagaagat
gctgaagaaacccacaaaggtatcagagaacatttggccaagaccattggtgctgaacaa
gctgaaaagaccagaatcttgtacggtggttctgccaacggtaagaatgccccaaccttc
aaagacaaagccaatgttgatggtttcttagtcggtggtgcttcattgaaaccagaattc
gttgacattatcaaatccagacaataa

DBGET integrated database retrieval system