KEGG   Candida tropicalis: CTRG_05787Help
Entry
CTRG_05787        CDS       T01115                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ctp  Candida tropicalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTRG_05787
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CTRG_05787
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CTRG_05787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MTNSFTIVVKLGTSSLVDEVTREPRIANMSLIVETIVKLRRQGHKIVIVSSGAIAFGMKR
VGLEEKPSKLAAIQALASIGQGRLIGLFDDLFRQMEQPIAQILITRNDIMDFTQYKNAQN
TVNELLDMGIIPIVNENDTLSVSEIKFGDNDTLSAITAGIIHADYLFLMTDVECLYTDNP
RTNPDAQPILIVDKIDELAVKTDTESGAGSKVGTGGMTTKLIAAELATNIGVTTIITLSS
QPHYILDIVSHIQSQSDSLTIDQQRESMMQDVKAGKLPLHTRFLSLPQDTQIKSDKRFWL
LHGLKTKGALIIDQGCFQALTRKNRAGLLPVGIIDVVGHFHESECVSIKVVPDKNGPLED
AVEVGHCRVNYSAPEIKLIKGHKSSDIEAILGYADSEYVAHRDNLAFPPVMPPSTDSLVS
MVENL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatctgttcactatcgttgttaaacttggaacctcatcattggtagatgaagtc
acaagagaaccaagaattgcaaatatgtctcttattgtggagaccatagtcaagttgcgt
cgacagggacataaaatagttattgtatcctcaggtgcaattgcatttggtatgaaacgt
gtgggattagaagagaagccaagtaaattggctgctatacaagctttggcatctataggt
caaggcagattgattggattatttgacgatttgttccgtcaaatggaacaaccaatagca
caaattttaattactagaaatgatattatggatttcacacagtataagaatgcccaaaac
actgttaatgagttattagatatggggataattccaattgtgaatgaaaatgatactttg
tctgtttcggaaattaagtttggtgataatgatactttgtcagctataactgcaggtata
atccatgcggattatttgttcctcatgacagatgtggaatgtttatacactgataatcca
agaaccaatccagatgcacaaccaatattgattgttgataaaatagatgagttggcagtg
aaaacagataccgaatctggagctggatccaaagtgggtactggtggtatgacgacaaag
ttgattgcagcagagttggccacaaacattggtgtaacaacaattattacattgtcgagc
caaccacattacatcctcgatattgtctcgcatatacagagtcaatctgattcgttaacg
atagatcagcaacgtgaactgatgatgcaagacgtcaaggctggaaaacttccattgcat
actagattcttgagcttaccacaggatacacagattaaatctgacaaaagattctggttg
ttgcatggattgaaaaccaagggtgcattgatcattgatcaagggtgtttccaagcatta
acaagaaagaatcgtgctgggctattacctgttggtattatcgatgttgtcggtcacttt
catgaaagtgaatgtgtatcaattaaagttgttccagataagaatggtccattggaagac
gctgttgaagtgggacactgtcgtgtgaactacctggctccagaaattaaacttatcaag
ggacacaagagtagtgatattgaagcgatattaggatatgctgatagtgaatacgtcgct
catagagacaatttagcattcccaccagttatgccaccatcaaccgattctttggtatcc
atggttgaaaatttatag

DBGET integrated database retrieval system