KEGG   Candida tropicalis: CTRG_05817Help
Entry
CTRG_05817        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ctp  Candida tropicalis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CTRG_05817
Translation factors [BR:ctp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CTRG_05817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 284 aa AA seqDB search
MAWDDEDFDIPSNNASAAVASWEDEEDDDPVLESWDVDPEEEERKKKAAKAEEAKRKAEL
KAKEDALKAKKDAKRKELEEFDQLDEKTRKELLRKAELNADLNNAADLFGGLGVAGDDED
FDINEHPRERANKQKLAAAAAKRPVLTKDTPLEEHPLFQPTNKAEYEKLRKTLGTTLTAL
SEDSPLLYSSNLAIDLIRDLSQPLSVEHLRKVISTLNVVIKEKEKQERQARLKKAGGTAT
GGAGKKKAKPAARPNVGGGGGFKKDAFADLDDGQFDDFDDDDFM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggacgacgaagattttgatattccatcaaacaatgcatcagctgctgtagca
tcatgggaagatgaagaagatgatgatccagttttagaatcttgggatgttgatccagaa
gaagaagaacgtaaaaagaaagcagctaaagctgaagaagctaaaagaaaagctgaatta
aaagctaaagaagatgctttgaaagctaagaaagatgcaaaaagaaaagaattggaagaa
tttgatcaattggatgaaaaaacacgtaaagaattgttaagaaaagccgaattgaatgct
gatttaaacaatgccgctgatttatttggcggtttgggtgttgctggagatgatgaagat
tttgatattaatgaacatccaagagaaagggccaataaacaaaaattagcagcagctgct
gctaaaagaccagtattgactaaagatactccattagaagaacatccattatttcagcca
accaacaaggccgaatacgaaaaattaagaaaaactttgggtaccactttaactgcatta
agtgaagattctcctttattatattcatctaatttagccattgatttaattagagattta
tcccaacctttatctgtcgagcatcttaggaaagtcatcagtactttaaatgttgtcatc
aaagaaaaggaaaagcaagaaagacaagcaagattaaagaaagctggtggtactgccact
ggtggtgctggtaagaaaaaggctaaaccagccgctagaccaaacgttggtggtggtggt
ggtttcaaaaaggatgcctttgctgatcttgatgacggtcaatttgatgattttgatgat
gatgatttcatgtaa

DBGET integrated database retrieval system