KEGG   Candida tropicalis: CTRG_05880Help
Entry
CTRG_05880        CDS       T01115                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ctp  Candida tropicalis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CTRG_05880
Enzymes [BR:ctp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     CTRG_05880
Glycosyltransferases [BR:ctp01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CTRG_05880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 730 aa AA seqDB search
MSKVLPSGYSQGPFRPYHTSKPLLDGNNKYSWTSLDNLLIFMILLLSLLRLYKLYIPDRV
VFDEIHIIRHIKQYYSGKIFVDVHPPLGNLIYYYITKLFKFNLLELEDLEQIGDLYPLKF
PYLWLRLFSGICGIGHILFTYLTLRTSCNSFISFIGSLFVCFENSLITDSRLILLDGPLL
FFQTLVIFNYKSFTKSEQFTKSWWIYLISTGVCLGLNISTKLSGGFNYIWVGILTMVQLW
EILGDLKVSIIQWILHVISRIVSLIMIPLTIYCSVFYIHFGLLPKEGSGSGFLSPHFRST
LEDYETSPLPVLYGSTVTIKHNGLEKYLSSHDANYPRGSENQQVSLYEFPDENNEWVIET
KHKFYENKIMSTKKDLKDGAIVRIYHKKTGHYLHVTDNNAPLSEQEYTFEVSCNETRGLL
GDDTYEFRLRTVLKKPHSENDLPLIKLRSTETVFQLIHRDKNCLLMSHPTRLPEWGNYQN
EVVCVKEGTIPNSLWYIESNSHPLLNNPQDLKKFPKFSFWQKLLEIHKVMFRLNESFTIK
HDYSSYPIEWPFLNRGILFFNNSGLKLIDEESSLIYYLGNIAIYYSVNIVVLLTWFKYCI
FAFINMNPYKQPTDSPEFKTTFYTNSWQYLLGWGINYLPYLFMSRNLYLHHYLPALSFGI
LLLAQYLNYRYSKNQIFGIALVGALSASVIYCFIEFIPIIYGLPWTLETCTKHKWFSFFN
WDIDCMAYTG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagtcctaccactgggttattcacagggtccttttcgaccatatcatacatca
aaaccactacttgatggaaataataaatattcatggacgagtcttgataatttattaatt
ttcatgattttattattatcattattacgattatataaattatatatccctgatagagtt
gtatttgatgagattcatattattagacatattaaacaatattatctgggtaagatcttt
gttgatgttcatcctcctttaggtaatttgatttattattatattacaaaattattcaaa
tttaatttattggaattggaagatcttgaacaaattggtgatttatatcctttgaaattt
ccatatttatggttaagattatttagtggtatttgtggtattggtcatatattgttcaca
tatttaacgctaagaacttcatgtaattcatttatttcattcattggatctttatttgtt
tgttttgaaaattctttaattactgattcaagattgattttattagatggtccattatta
tttttccaaactcttgttatatttaattataaatcatttactaaatcagaacaatttact
aaatcttggtggatttatcttatttctactggggtttgtttaggtttgaatatttcaact
aaattatccggtggatttaattatatctgggttgggattttaactatggttcaattatgg
gaaatcttgggtgatttaaaagtatctataattcaatggattctacatgttatttcacga
attgtttcattgattatgataccattaactatttattgttcagttttttatattcatttt
ggtttattacctaaagaaggtagtggatcaggatttttatcacctcattttagatctact
ttagaagattatgaaacatctccattaccagtattatatggaagtacagttactattaaa
cataatggattagaaaaatatttaagttcccatgatgctaattatccaagaggttcagaa
aatcaacaagtttctttatatgaatttcctgatgaaaataatgaatgggtaattgaaact
aaacataaattctatgaaaataaaatcatgtcaacaaagaaagatcttaaagatggagca
attgttcgaatttatcataaaaaaactggtcattatttacatgttactgataataatgct
ccactttctgaacaagaatatacttttgaagtaagttgtaatgaaacaagaggattatta
ggtgatgatacttatgaatttagactaagaactgttcttaaaaaacctcattctgaaaat
gatttacctttaattaaacttagatcaacagaaactgtatttcaattaattcatcgtgat
aaaaattgtttattaatgagtcatcctactagattacctgaatggggtaattatcaaaat
gaagtagtttgtgttaaagaaggtactattccaaattcattatggtatattgaactgaat
tctcatccattattgaataatccacaagatttgaagaaatttccgaaattttcattctgg
caaaaattattggaaattcataaagttatgtttagattaaatgaaagttttactattaaa
catgattattcttcatatccaatagaatggccatttttgaatcgtggtattttatttttt
aataattctggtttaaaacttattgatgaagaatcaagtttgatttattatttgggtaat
attgcaatttattatctggttaatattgttgttttattaacttggtttaaatattgtatc
tttgcatttattaatatgaatccttataaacaaccaactgactcaccagaattcaaaaca
accttctatacaaattcatggcaatatttacttggatggggaattaattatttaccatat
cttttcatgtcaagaaacttgtatttgcatcactatttacctgcattgagttttggtatt
ttattattagctcaatatttgaactatcgatactccaagaaccaaatctttggcattgca
ttggttggtgcactttcagccagtgtgatttattgtttcattgagtttattccaatcata
tatggtttaccatggactttagaaacctgtaccaaacataaatggttttccttcttcaat
tgggacatagattgtatggcatacacaggataa

DBGET integrated database retrieval system