KEGG   Candida tropicalis: CTRG_05954Help
Entry
CTRG_05954        CDS       T01115                                 

Definition
similar to Mps1p
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ctp  Candida tropicalis
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ctp04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 697 aa AA seqDB search
MPDDIPLGSAITSSINSHLNLHSHSHYSSSPYGQNNSSSTKRRLPFEDDQTVLPPALSSY
GIQCFNERSKSSTNRNKVTGKYELDFPEANKRDNTLRNKLAVHLTNNDSSLEISKSLTHL
TNDRMTGITSATSATTAPEVKTPSEIRVKRTRRFGKSLGRARRISETNNHSSSPNAANNL
VDNNDTPGDSSKNSIRTDVQQQAPSIDRFSPRLSGHLLSREDEEDIMKRVEARRRELQEK
EILLKREQEKVAQEILIRETELPALQSPFEDKNSREKDQPRVPLRDIPVNQVDSFRKPKL
PKSVSPNLVPNQSPRVGASPIPTNQQNQIPSSNAVSESNVSSIQAGVSASSTIMASDRPQ
SSRNRRALVINGKQYEKFELLGKGGSSKVYRVKLLSNNCFYALKKVTLDNHEDINGFQGE
IALLQKLRSCTRVVKLIDHAVTETSIYLIMEKGDLDLAEVLHNRARHGVAFDVDFVRYHV
LEMFKCLREVHDAGVVHSDLKPANFLFVKGMLKLIDFGIANAVPDHTMNIYRENQIGTPN
YMAPEAIGETSVRNLWRVGKPSDIWSIGCMLYQFVYGKPPFHGYSGSQKIIAITNPQVKI
PFPTHGIGNVAVPHSAIELMQNCLHRNPDDRWTIEQCLKSDFLSPKVVSENFIREIVHQS
VNYGYNSRISGDNMTSDSYDSLVNSVLKRLEDLRYCQ
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgccagatgatatacctttgggtctggctataacttcatccataaatctgcatctaaat
ctacatctgcatctgcattatctgtcatcaccatatggtcaaaacaatagtagctctacg
aaacgacgcctaccttttgaagatgaccaaaccgtcctaccaccagcattaagttcatat
ggaatccagtgttttaatgaacgatctaaatcttccactaatagaaacaaagtgacaggg
aaatatgaattggattttccagaggcaaataaacgagacaatacactacgaaataaactt
gcagtccatcttacaaacaatgattcatcacttgagatatccaagtcattgacccatttg
acaaatgatagaatgactggtattacttctgctacttctgcaaccactgctccagaagtt
aaaactccatcagaaattcgtgtcaaaagaactagaagattcggtaaactgttgggccgt
gcaagaagaatcagtgaaacaaacaatcattcatcatcaccaaatgcggcaaataattta
gttgataacaatgatactcctggcgattcttcaaaaaatagcatacgtacagatgtccaa
cagcaagcaccaagtattgatagattttcccctaggttaagtggacatttattgagtcga
gaagatgaagaagacattatgaaacgagtagaagcaagaagacgggaacttcaggaaaag
gaaatattgttgaaaagagaacaagaaaaagtggcacaggaaatattaataagagaaact
gaacttccagctcttcaatctccatttgaggataagaattctcgagagaaagatcaacca
agagtgcctcttcgtgatattcctgtgaatcaagtcgatagtttccgtaaaccaaaactc
ccaaagtcagtttcacccaatttggttccgaatcaatcgccgagagttggcgcctcccct
atccccaccaatcaacagaaccaaattccatcatcaaatgctgtttctgagtcaaatgtc
tcgtctatacaggctggtgtctctgcttcctctacaataatggcttcagatagaccccag
tcatcacgaaatagaagagcattagttattaatgggaaacagtacgaaaagtttgagctt
cttgggaaaggtggttcatcaaaagtgtacagggtaaaacttttaagcaacaactgtttt
tatgcacttaaaaaagttacccttgacaatcatgaagatatcaatgggtttcaaggtgaa
attgcattgcttcagaaattaaggtcttgcacaagagtagttaaacttattgatcatgca
gttactgagacatcaatttatcttattatggaaaagggtgatcttgaccttgcagaagtg
ttacataatagagcaagacatggagtggcttttgatgttgattttgttagatatcatgtt
cttgaaatgtttaaatgtctccgagaagtccacgatgctggcgttgtgcacagtgattta
aaaccagctaattttttatttgtcaaagggatgttgaaacttattgattttggtattgct
aatgccgtcccagatcacacaatgaatatttatcgagagaatcaaattgggacaccaaat
tacatggcacctgaagcaataggagaaacatctgtgcgaaatctttggcgagttggtaaa
ccatctgatatctggtcaattggttgcatgctttatcaatttgtctacggtaaaccccca
tttcatggttattctggtctgcaaaagataatagcaattaccaaccctcaagtcaagatt
ccattcccaactcatggaataggtaatgttgctgttcctcatagtgctattgaattgatg
caaaattgtttacatagaaatccagatgatcgttggacaatcgagcagtgtcttaaaagc
gatttccttctgccaaaagtcgtttctgaaaatttcattagagagatagtacaccagagt
gtaaattatggttataacagcagaatctcaggagataatatgacaagtgatagttatgat
tcgcttgtgaatctggttttaaagcgattggaagatctaagatattgtcaatag

DBGET integrated database retrieval system