KEGG   Candida tropicalis: CTRG_05965Help
Entry
CTRG_05965        CDS       T01115                                 

Definition
similar to kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CTRG_05965
Protein kinases [BR:ctp01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CTRG_05965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 509 aa AA seqDB search
MGTGWELTQALKDKIYKYASFNQTPVSLRQMVQFGPTPSPGSIFLASKFIVEELPIRLAK
KVKDLDNAPLGLSKMPSTIKVKNWYAQSFQELTELHKPTINEELAKLLFNGATKQPVPED
TITEQPHIKKEIHHIPDSNDDNPAINNIFSDDGIVVRHHHHHHSVSRTSARQGDSTQARV
ESPTYGMTYFNPCPINIVWPKEVYDYNKLVKETLDVIKKRHDATVATMAQGVQEWKAENQ
TVLVNSQIQTFLDRFYMSRIGIRMLIGQHIALNLAQNSPTKQRFSALINGSQGNTKKPRS
NYVGVICTDCNVGEIAEDAIETAKYICEEHYGLFEAPEVQLIAPSQDISFMYVPGHLIHM
LFETLKNSLRATIEFHTPKLKQELMEKDPSLKYDEIDLNDLKFPPIKVIISEGTEDITIK
VSDEGGGIARSSLPLVWTYLYTTVDETPKLDSDETSFKAPMAGFGYGLPISRLYSQYFGG
DLKLISMENYGTDVYIHLNRLSSSNEPLP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtaccggttgggaattaacccaagcgttgaaagacaagatctacaaatatgcttca
ttcaaccaaacccctgtatctttaagacaaatggtccagtttgggccaactccatccccg
ggatctatatttttagcatcaaagttcatcgtggaagagttaccaataagattggcaaaa
aaagtgaaagatctagataatgccccattgggtttaagcaaaatgccgtccaccatcaaa
gtaaagaactggtatgcccaatctttccaagaattgacagagttacataaacctacaata
aatgaagagttagctaaacttttattcaatggtgcaactaaacaaccagtgccagaagac
accataactgaacaaccacatatcaagaaagaaatacatcacataccggattccaacgat
gacaacccagcaatcaacaacatcttcagtgacgatggtatagttgttcgacatcatcac
caccaccattcggtatcacgaacttcggcacgtcaaggtgatagtacacaagctcgtgtc
gagtctcctacttatggcatgacttatttcaatccatgtcctattaacattgtttggcca
aaagaagtttatgactacaataagttggtgaaagagacattggatgtgattaagaaaaga
cacgatgccactgtggcaaccatggctcaaggtgtgcaagaatggaaagctgaaaaccaa
accgtattggtgaattcccagattcaaacatttttggatcgtttctatatgtcacgaatc
ggaatcagaatgttaattggacaacatattgcattgaatttggcccaaaattccccaacc
aaacagagatttagtgcattaattaacggttcccaaggtaacaccaaaaaaccacgctca
aactatgttggtgtcatctgtactgattgtaacgttggagaaatagctgaagatgctatt
gaaaccgctaaatacatttgtgaagagcactatgggttgtttgaagctcctgaagtacaa
ttgattgctcctagtcaggatattagtttcatgtatgttcctggtcatttgatccatatg
ttgtttgaaactttgaaaaattcgcttagagctactattgaattccacacaccaaaattg
aaacaagaattaatggaaaaggacccaagtttgaaatatgatgagattgacttgaacgat
ttgaagttcccaccaatcaaggtgatcatatcagaaggaactgaagatattacaatcaaa
gtatcagatgaaggaggtggtattgcccgttcctccttgccattagtctggacatatttg
tacacaactgtggatgaaacaccaaaattggattcagatgagacctccttcaaagctcca
atggctggttttgggtatggtcttccaatcagtagattgtattcgcagtactttggtggt
gacttgaagttgatctccatggaaaactacggtactgatgtatacattcatctcaataga
ttgagtagtagtaacgagccgcttccatga

DBGET integrated database retrieval system