KEGG   Candida tropicalis: CTRG_06030Help
Entry
CTRG_06030        CDS       T01115                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ctp  Candida tropicalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTRG_06030
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CTRG_06030
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CTRG_06030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 318 aa AA seqDB search
MSSTIPYKYYPTKKATIITAPFSGGQPKGGVELGPEYILKAGFQKQIESLGWASEIDSPL
EGTDYEKLKSNEKDSFGIKNTKIVNDCCKKIHESVKKSLKENKLPITIGGDHSIGTATIS
ASLANNPDTCIVWVDAHADINTPKTTDSGNLHGCPVSFVMGIDRESYPPEFDWVPQLLKA
NKIVYIGLRDVDDGEKAILRKYNIPAFSMYHVDKYGIGKVVEMALDKVNPNRDCPIHLSY
DVDAIDPSFVPATGTRVEGGLSLREGLFIAEEIAQSGLLGGLDIVETNPMLAETEEHVLD
TVSAACAIGRCALGQTLL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaactattccatataaatattatccaactaaaaaggctactataataacagct
ccattttctggtggtcaaccaaaaggcggtgttgaattaggtcctgaatatattcttaaa
gctggtttccaaaaacaaattgaatctctaggctgggccagtgaaatcgatagtcctttg
gaaggtaccgattatgagaaattaaaatctaatgaaaaagattcctttggaattaaaaac
actaaaattgttaatgattgttgtaagaaaatccatgaatctgttaaaaaatcattaaaa
gaaaacaaattacctatcactattggtggtgatcattctattggtactgctactattagt
gctagtttagctaataatccagacacttgtattgtttgggttgatgctcatgctgatatc
aacacaccaaagactacagactctggtaatttacacggttgtccagtaagttttgtcatg
ggtattgatagagaaagttatccacctgaatttgattgggttccacaattgttaaaagct
aataaaatcgtatacattggattaagagatgttgatgatggtgaaaaggcaattttacgt
aaatataacatccctgctttttcaatgtatcatgttgataaatatggtattggtaaagtt
gttgaaatggctttagataaagttaatccaaatagagattgcccaatccatttatcttat
gatgttgatgctattgatccaagctttgttcctgctactggtactagagttgaaggtgga
ttgagtttaagagaaggtttatttatcgctgaagaaattgctcaatctggtcttttgggt
ggattagatatcgttgaaactaacccaatgttggctgaaactgaagaacatgtattagat
acagttagcgcggcctgtgccattggtagatgtgccttgggtcaaacgctattatag

DBGET integrated database retrieval system