KEGG   Candida tropicalis: CTRG_06042Help
Entry
CTRG_06042        CDS       T01115                                 

Definition
similar to potential thioredoxin
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ctp  Candida tropicalis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CTRG_06042
Enzymes [BR:ctp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CTRG_06042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 299 aa AA seqDB search
MIWNRLLALISLLVLVTSRAQGDEYANDDNIFELTPSNFDKVVHKSNYTTIVKFYAPWCG
YCQQLKPTYKKLGKYIHENAKYAVNVASVNCDKEYNKPLCSQYQIRGFPTLMVFRPPKYQ
SGKPTRKQNHASEVYQGERNVKAMTKFLTSRLKNYVTKFHNVNSNGIAEWLQEEKPNVLL
ITNTNSISPLLKSIAIDFLDRVNIGIITKLNSEPRTIEVDGNEVEIPAATKSTLLYFDKD
NKKFVTYDKSDKLNDKEVISEWIIKQTKQQPIEGPLSKKEKKYYYKYRTGKKKIEHDEL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatttggaatagattattagcacttatttcgttgttggtcttggtcacttccagagcc
caaggagatgaatatgcaaatgatgacaacatttttgaattaaccccttcgaattttgac
aaagttgttcacaagtcaaattataccaccattgtcaaattttatgctccatggtgtggt
tactgtcaacagttaaagccaacctacaaaaagttgggtaaatatatccacgagaatgcc
aagtatgctgttaatgttgccagtgttaattgtgataaagaatacaataaaccattatgt
tcacaatatcaaatacgtggtttcccaaccttaatggtctttagacctccaaagtatcaa
agtggtaagccaactagaaaacaaaaccatgcaagtgaagtctatcaaggtgagagaaat
gtcaaggctatgacaaagtttttaacttcaagattaaagaactatgttaccaaattccac
aatgtcaactcaaatggtattgccgaatggttacaggaagaaaagccaaatgtcttgctc
atcaccaataccaacctgattagtccattgctaaaatctattgccattgatttccttgat
agagtcaatattggtataattacaaaacttaactcagagccacgcactattgaagttgat
gggaatgaagtagaaattccagccgcaactaaatcaacattgctctactttgacaaggat
aacaagaagtttgttacatatgataagtctgacaaattaaatgataaggaagtcatttcc
gaatggataatcaaacaaactaaacaacagcctatagaaggtccattgtcaaagaaagag
aagaaatactactacaagtacagaacaggaaagaaaaagattgaacatgatgaattataa

DBGET integrated database retrieval system