KEGG   Candida tropicalis: CTRG_06047Help
Entry
CTRG_06047        CDS       T01115                                 

Definition
hypothetical protein
Organism
ctp  Candida tropicalis
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 262 aa AA seqDB search
MSENLKRAESLFNRIMNPGTHDSSISLNSQSSTGTSSITPVTSSTQLNLSSITSGPNFSG
STTSNVTSNIIPKKYTVPTKIPKLDIDKLTHDALATVPLNHHTLPYCWTIWYHSRAKKNQ
PSMNQEEGESPEEQQQQQQQQNPGVDLYLQTTNELSFWDPTTGNKIQHIASLEQLWSSLS
SIKKTFDLNIGTEFLIFKAGVNPVWEDPINSKGGRWVFRFNRKLIDDDFEKQEKLRKRTS
LIWERLLIKTLTGIINSSRIEF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatttaaaaagagcagaatcattgtttaatagaattatgaatcctggaact
catgattcatctatatcattaaattctcaaagttcaacagggacatcatcaattacacca
gtaacctcaagtactcaattaaatctatcctcaattacatcaggaccaaatttttccgga
tcaacaactagtaatgtgacaagtaatataattccaaagaaatatactgttcctactaag
attcctaaattggatattgataaattgactcatgatgcattagctaccgtaccattaaat
catcacacattaccttattgttggacaatatggtatcattccagagctaaaaagaatcaa
ccatcaatgaatcaagaagagggtgaatcaccagaagagcaacaacagcaacagcaacaa
caaaacccaggagttgatttgtacttgcaaacaaccaatgaattatccttttgggatcca
actacaggaaacaaaattcaacacattgcatcattagaacaattatggagtagtttgtca
tcgattaagaaaacatttgatttgaatatcggtactgagtttttaatattcaaggctggg
gttaatccagtatgggaagatccaataaattcaaaaggtggaagatgggtatttcgattt
aatagaaaactaatcgatgatgattttgaaaaacaagagaaattaagaaagagaactagt
ttaatttgggaaagattattgattaaaactttaactgggatcattaattcctcaaggatc
gaattctga

DBGET integrated database retrieval system