KEGG   Candida tropicalis: CTRG_06075Help
Entry
CTRG_06075        CDS       T01115                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ctp  Candida tropicalis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTRG_06075
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CTRG_06075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 281 aa AA seqDB search
MSELQSSKSNNRKDEINGNHSPKSVLPIKRSKLVPSGSSTTNHISAALPRDLIETPLQTR
AASPLILNPPIDSDGLSWPSQGARQRIEQSPEEAKAREERIADAVKVILEELGEDTTREG
LLETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFG
KAHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQIAMALSEILKPRGVAVVIEATH
MCMVSRGVQKTGSSTTTSCMLGCFRDHQKTREEFLTLLGRK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattacaactgtcaaaatctaataatcgtaaagatgaaattaatggaaatcat
tccccaaaatccgttttaccaataaaacgttccaaacttgttccttctggttcatctaca
acaaatcacatcagtgcagcattacctagagatttaatagaaactccattacaaactcgt
gctgcatcaccattaattttaaatccaccaattgatagtgatgggttatcatggccatct
caaggagctagacaaagaatcgaacaaagtccagaagaagccaaggcaagagaagaaaga
attgctgatgctgttaaagttatattggaagaattaggtgaagatactactagagaagga
ttattagaaactcctgaacgatatgctagagcaatgttgtattttaccaaaggttatgaa
gataatattcgtgatgttattaaaagagcagtatttgaagaagatcatgatgaaatggtt
attgttcgtgatattgaaatttattccctttgtgaacatcatttagttccattttttggt
aaagctcatattgcttatattccaaataaaagagtcttaggattaagtaaattagcaaga
ttagctgaaatgtattcaagaagatttcaagttcaagaaagattaactaaacaaatcgcc
atggctttaagtgaaattttaaaaccaagaggtgttgctgtggttattgaagccacccat
atgtgtatggttagtagaggggtacaaaaaactggatcaagtactaccactagttgtatg
ttgggttgttttagagatcatcaaaaaactagagaagagtttttgactttattaggaaga
aaataa

DBGET integrated database retrieval system