KEGG   Candida tropicalis: CTRG_06094Help
Entry
CTRG_06094        CDS       T01115                                 

Definition
6-phosphofructokinase alpha subunit
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTRG_06094
   01230 Biosynthesis of amino acids
    CTRG_06094
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_06094
   00030 Pentose phosphate pathway
    CTRG_06094
   00051 Fructose and mannose metabolism
    CTRG_06094
   00052 Galactose metabolism
    CTRG_06094
  Energy metabolism
   00680 Methane metabolism
    CTRG_06094
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTRG_06094
Protein phosphatases and associated proteins [BR:ctp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTRG_06094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 982 aa AA seqDB search
MPSSDSINRISYVSLVTSVVEQFNDAFKFYSALGFRLTKNFSRVSTNGSASGSHDPKLLL
GVSHDSLKEVWLESYPLQEVDENGNIRPWQEMEVYDGDNSEKLTESTVIKIRLSNELLPL
EACLLQKQFVFFTTELKSIEERLNKINVKVGKIGDNIIVTEDPIGNIISFSNTKNELCKK
TFKSAEEYIDIACDKILSERKQVELAKELLVEESASNRKTKKKIGVMTSGGDAPGMNPAV
RAVVRAGIYYGCDVYAVYEGYEGLVKGGDLLKKMEWADVRSYMSLGGTSIGTARCMEFRQ
REGRLQGAYNMIINGIDALVVCGGDGSLTGADLFRSEWPSLVQELVDTGRLTSEQVAPYR
HLTIVGLVGSIDNDMSGTDVTIGAFSSLERITEMVDYIGATAASHSRAFVVEVMGRHCGW
LALMSGIATGADFIFIPERPPKAGLWKEQLKEVCLRHRANGRRKTTVIVAEGAIDDELNP
ITSEEVKKVMVDLGLDTRNTILGHVQRGGTAVAYDRRLATLQGVEAIKAVLENTPETPSP
MIGVLNHKIVRTPLVDAVKQTKAVAEAIENKDFDKAMSLRDNNFYDAYRYFRDISIYDDG
KDKLVDESKRLNVAIVHVGAASAGLNAATRALVLYSLSRGHNLYAIQDGFHGLVNGHIKK
LNWLDVEGWHNLGGSEIGTNRSLPSQDYGKVAYNLQKYNIQGLIIVGGFEAFTSLHELTK
QKENYPVFKIPMVVVPATVSNNVPGSEYSLGSDTCLNQLVSYCDAVQQSASSTRRRVFVV
EVQGGHSGYVASYCGLITGSLATYTPETKINLKQLQDDIELLRKVFATDRGEDHNGTLLV
RNEQASSVYSTELVADIIKENANKRFETRTAIPGHVQQGFTPTANDRVMAVRFSLKAFEF
IEGWNKCYTKEDSKLSAEDIGEHAHVVIGIHGDVVEFTDVEHLYKNEANISLRKGNTIHW
NDMIEVSNILSGKLLLEKEGRF
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgcctagttcagattcaattaataggataagttatgtatccttggttaccagtgtagtt
gaacaatttaacgatgcattcaaattctattcagctttaggatttagattaactaagaat
ttctcaagagtttcaaccaatggttcagcatcaggtagtcatgatccaaaattgttattg
ggtgtttctcatgattcattaaaagaagtttggttggaatcttatccattacaagaagtt
gatgaaaatggaaatatccgtccatggcaagaaatggaagtttacgatggtgacaattct
gaaaaattgactgaatcaactgttatcaagattagattatcaaatgaattattacccctt
gaagcttgtttgcttcaaaaacaatttgtatttttcactaccgaattaaaatcaattgaa
gaaagattaaacaaaattaatgttaaagttggtaaaatcggagataatatcattgttaca
gaagatccaattggcaatattattagtttttcaaataccaaaaatgaattgtgcaagaag
acattcaaatctgctgaagaatatattgacattgcctgtgataaaatcttatctgaaaga
aagcaagttgaattggctaaagaattattagttgaagaatctgcttcaaacagaaagacc
aagaaaaagattggtgttatgacatcaggtggtgatgccccaggtatgaatccagctgtt
cgtgccgttgtcagagctggtatttactatggatgtgatgtttatgccgtttacgaaggt
tacgaaggtttagttaaaggtggtgatcttttgaaaaagatggaatgggctgatgttcgt
tcttatatgtcacttggtggtacttctattggtactgccagatgtatggaatttagacaa
cgtgaaggtagattacaaggtgcttataatatgattatcaatggtattgatgccttggtt
gtttgtggtggtgatggttccttaactggggctgatttgttcagaagtgaatggccatca
cttgttcaagaattggttgataccggtagattgacttcagaacaagttgctccttataga
catcttaccattgttggtttggttggttctattgataatgatatgtctggtactgatgtt
actattggtgctttttcatcattggaaagaatcactgagatggttgattatattggtgcc
actgctgcttcccattctcgtgcttttgttgtcgaagttatgggtagacattgtggttgg
ttagccttgatgtctggtattgccactggtgctgattttattttcattccagaaagacca
ccaaaagctggcttgtggaaagaacaattgaaagaagtttgtttaagacacagagctaat
ggtagaagaaagaccactgttattgttgctgaaggtgccattgatgatgaattgaaccca
attacttctgaagaagttaaaaaagtgatggttgatttaggtttagataccagaaacacc
attttaggtcatgttcaaagaggtggtactgctgtcgcttatgatagaagattggctact
ttacaaggggttgaagccattaaagctgttttggaaaacaccccagaaaccccatctcca
atgattggtgttttgaaccacaagattgttagaactccattagttgatgctgttaaacaa
actaaagctgttgctgaagccattgaaaacaaggatttcgacaaggctatgagtttgaga
gacaacaatttctatgatgcttatagatacttccgtgatatttccatttatgatgacgga
aaggacaaacttgttgatgaaagtaaaagattgaatgttgccattgttcacgttggtgcc
gcctctgcagggttgaatgctgctacaagagcccttgttttatacagtctttcacgtggt
cacaacttgtatgctattcaagatggtttccatggtttagttaatggacacatcaagaaa
ttgaattggttagatgttgaaggatggcataatcttggtggttctgaaattggtactaat
agatcattaccatctcaagattatggtaaagttgcttacaacttacaaaaatacaatatt
caaggtttgattattgttggtggttttgaagcttttacctcattacacgaattgactaaa
caaaaggaaaactacccagtatttaagattccaatggttgttgttccagctactgtttct
aataatgtcccaggttctgaatattctcttggttctgatacttgtttgaatcaattggtt
tcttattgtgatgctgttcaacaatctgcttcatctaccagaagaagagtttttgttgtt
gaagttcaaggtggacattccggttatgttgcctcatattgtggattgatcactggttca
ttggctacttatactccagaaaccaagattaatttgaaacaattacaagatgatattgaa
ttattacgtaaagtttttgctactgatcgtggtgaagatcacaatggtactttacttgtt
agaaatgaacaagcaagttctgtttattcaactgaattggttgctgatataattaaagaa
aatgccaacaaaagatttgaaactagaacagcaattccaggtcatgttcaacaaggtttt
actcctactgcaaatgatcgtgttatggctgttagattttctttgaaggcttttgaattt
attgaaggttggaataaatgttacactaaagaagacagcaaacttagtgccgaagacatt
ggtgaacacgcccatgttgttattggtattcatggtgatgttgttgaatttaccgatgtt
gaacatttgtataagaatgaagctaacatttcattgagaaaaggtaacactattcattgg
aatgatatgattgaagtttctaatatattgagtggtaaattgttattagaaaaagaaggt
agattctaa

DBGET integrated database retrieval system