KEGG   Candida tropicalis: CTRG_06094Help
Entry
CTRG_06094        CDS       T01115                                 

Definition
(RefSeq) 6-phosphofructokinase alpha subunit
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctp  Candida tropicalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTRG_06094
   01230 Biosynthesis of amino acids
    CTRG_06094
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_06094
   00030 Pentose phosphate pathway
    CTRG_06094
   00051 Fructose and mannose metabolism
    CTRG_06094
   00052 Galactose metabolism
    CTRG_06094
  Energy metabolism
   00680 Methane metabolism
    CTRG_06094
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CTRG_06094
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTRG_06094
Protein phosphatases and associated proteins [BR:ctp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTRG_06094
Messenger RNA biogenesis [BR:ctp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CTRG_06094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 982 aa AA seqDB search
MPSSDSINRISYVSLVTSVVEQFNDAFKFYSALGFRLTKNFSRVSTNGSASGSHDPKLLL
GVSHDSLKEVWLESYPLQEVDENGNIRPWQEMEVYDGDNSEKLTESTVIKIRLSNELLPL
EACLLQKQFVFFTTELKSIEERLNKINVKVGKIGDNIIVTEDPIGNIISFSNTKNELCKK
TFKSAEEYIDIACDKILSERKQVELAKELLVEESASNRKTKKKIGVMTSGGDAPGMNPAV
RAVVRAGIYYGCDVYAVYEGYEGLVKGGDLLKKMEWADVRSYMSLGGTSIGTARCMEFRQ
REGRLQGAYNMIINGIDALVVCGGDGSLTGADLFRSEWPSLVQELVDTGRLTSEQVAPYR
HLTIVGLVGSIDNDMSGTDVTIGAFSSLERITEMVDYIGATAASHSRAFVVEVMGRHCGW
LALMSGIATGADFIFIPERPPKAGLWKEQLKEVCLRHRANGRRKTTVIVAEGAIDDELNP
ITSEEVKKVMVDLGLDTRNTILGHVQRGGTAVAYDRRLATLQGVEAIKAVLENTPETPSP
MIGVLNHKIVRTPLVDAVKQTKAVAEAIENKDFDKAMSLRDNNFYDAYRYFRDISIYDDG
KDKLVDESKRLNVAIVHVGAASAGLNAATRALVLYSLSRGHNLYAIQDGFHGLVNGHIKK
LNWLDVEGWHNLGGSEIGTNRSLPSQDYGKVAYNLQKYNIQGLIIVGGFEAFTSLHELTK
QKENYPVFKIPMVVVPATVSNNVPGSEYSLGSDTCLNQLVSYCDAVQQSASSTRRRVFVV
EVQGGHSGYVASYCGLITGSLATYTPETKINLKQLQDDIELLRKVFATDRGEDHNGTLLV
RNEQASSVYSTELVADIIKENANKRFETRTAIPGHVQQGFTPTANDRVMAVRFSLKAFEF
IEGWNKCYTKEDSKLSAEDIGEHAHVVIGIHGDVVEFTDVEHLYKNEANISLRKGNTIHW
NDMIEVSNILSGKLLLEKEGRF
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgcctagttcagattcaattaataggataagttatgtatccttggttaccagtgtagtt
gaacaatttaacgatgcattcaaattctattcagctttaggatttagattaactaagaat
ttctcaagagtttcaaccaatggttcagcatcaggtagtcatgatccaaaattgttattg
ggtgtttctcatgattcattaaaagaagtttggttggaatcttatccattacaagaagtt
gatgaaaatggaaatatccgtccatggcaagaaatggaagtttacgatggtgacaattct
gaaaaattgactgaatcaactgttatcaagattagattatcaaatgaattattacccctt
gaagcttgtttgcttcaaaaacaatttgtatttttcactaccgaattaaaatcaattgaa
gaaagattaaacaaaattaatgttaaagttggtaaaatcggagataatatcattgttaca
gaagatccaattggcaatattattagtttttcaaataccaaaaatgaattgtgcaagaag
acattcaaatctgctgaagaatatattgacattgcctgtgataaaatcttatctgaaaga
aagcaagttgaattggctaaagaattattagttgaagaatctgcttcaaacagaaagacc
aagaaaaagattggtgttatgacatcaggtggtgatgccccaggtatgaatccagctgtt
cgtgccgttgtcagagctggtatttactatggatgtgatgtttatgccgtttacgaaggt
tacgaaggtttagttaaaggtggtgatcttttgaaaaagatggaatgggctgatgttcgt
tcttatatgtcacttggtggtacttctattggtactgccagatgtatggaatttagacaa
cgtgaaggtagattacaaggtgcttataatatgattatcaatggtattgatgccttggtt
gtttgtggtggtgatggttccttaactggggctgatttgttcagaagtgaatggccatca
cttgttcaagaattggttgataccggtagattgacttcagaacaagttgctccttataga
catcttaccattgttggtttggttggttctattgataatgatatgtctggtactgatgtt
actattggtgctttttcatcattggaaagaatcactgagatggttgattatattggtgcc
actgctgcttcccattctcgtgcttttgttgtcgaagttatgggtagacattgtggttgg
ttagccttgatgtctggtattgccactggtgctgattttattttcattccagaaagacca
ccaaaagctggcttgtggaaagaacaattgaaagaagtttgtttaagacacagagctaat
ggtagaagaaagaccactgttattgttgctgaaggtgccattgatgatgaattgaaccca
attacttctgaagaagttaaaaaagtgatggttgatttaggtttagataccagaaacacc
attttaggtcatgttcaaagaggtggtactgctgtcgcttatgatagaagattggctact
ttacaaggggttgaagccattaaagctgttttggaaaacaccccagaaaccccatctcca
atgattggtgttttgaaccacaagattgttagaactccattagttgatgctgttaaacaa
actaaagctgttgctgaagccattgaaaacaaggatttcgacaaggctatgagtttgaga
gacaacaatttctatgatgcttatagatacttccgtgatatttccatttatgatgacgga
aaggacaaacttgttgatgaaagtaaaagattgaatgttgccattgttcacgttggtgcc
gcctctgcagggttgaatgctgctacaagagcccttgttttatacagtctttcacgtggt
cacaacttgtatgctattcaagatggtttccatggtttagttaatggacacatcaagaaa
ttgaattggttagatgttgaaggatggcataatcttggtggttctgaaattggtactaat
agatcattaccatctcaagattatggtaaagttgcttacaacttacaaaaatacaatatt
caaggtttgattattgttggtggttttgaagcttttacctcattacacgaattgactaaa
caaaaggaaaactacccagtatttaagattccaatggttgttgttccagctactgtttct
aataatgtcccaggttctgaatattctcttggttctgatacttgtttgaatcaattggtt
tcttattgtgatgctgttcaacaatctgcttcatctaccagaagaagagtttttgttgtt
gaagttcaaggtggacattccggttatgttgcctcatattgtggattgatcactggttca
ttggctacttatactccagaaaccaagattaatttgaaacaattacaagatgatattgaa
ttattacgtaaagtttttgctactgatcgtggtgaagatcacaatggtactttacttgtt
agaaatgaacaagcaagttctgtttattcaactgaattggttgctgatataattaaagaa
aatgccaacaaaagatttgaaactagaacagcaattccaggtcatgttcaacaaggtttt
actcctactgcaaatgatcgtgttatggctgttagattttctttgaaggcttttgaattt
attgaaggttggaataaatgttacactaaagaagacagcaaacttagtgccgaagacatt
ggtgaacacgcccatgttgttattggtattcatggtgatgttgttgaatttaccgatgtt
gaacatttgtataagaatgaagctaacatttcattgagaaaaggtaacactattcattgg
aatgatatgattgaagtttctaatatattgagtggtaaattgttattagaaaaagaaggt
agattctaa

DBGET integrated database retrieval system