KEGG   Candida tropicalis: CTRG_06124Help
Entry
CTRG_06124        CDS       T01115                                 

Definition
calcineurin subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ctp  Candida tropicalis
Brite
Protein phosphatases and associated proteins [BR:ctp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CTRG_06124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 173 aa AA seqDB search
MGANSSILNGFMEDTNFSIEEIHRMRKRFMKLDKDGSGEIDKQEFLSIPGISSNPLATRL
MDVFDTDGDGRIDFEEFITGLSAFSGKSDNLTKLKFAFNIYDIDRDGYIGNGELFIVMKM
MVGKNLQDEELQQIVDKTIMEADLDGDGKLNFEEFQKAVNTDSIANTLTLNLF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgggggccaattcaagtattttaaatggattcatggaagatacaaacttcagtattgaa
gaaatacatcgtatgcgtaaaagattcatgaagttggataaagatgggtcaggggaaatt
gacaaacaagagtttttatctatacctggaatttcttcaaacccattggctacaagacta
atggatgtatttgacacagatggtgatggtcgtattgactttgaagaatttatcaccggt
ttatctgcattctctggtaaatcggataacttgacaaaattgaagtttgcattcaatatt
tatgatatcgatagagatggttatattgggaatggtgaacttttcattgtcatgaagatg
atggtgggtaagaatttacaagatgaagagttacaacaaattgttgacaaaactatcatg
gaagctgatttggacggtgacgggaagttgaactttgaagagttccaaaaagcagtgaat
acagattccattgcaaacacattgacgttgaacttgttttaa

DBGET integrated database retrieval system