KEGG   Candida tropicalis: CTRG_06195Help
Entry
CTRG_06195        CDS       T01115                                 

Definition
histone acetyltransferase ESA1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CTRG_06195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MTQNHSEVARVRNLSSIILGEHIIEPWYFSPYPIELTEEDEIYICDFSLCYFGSKKQFER
FRSKCTLKHPPGNEIYRDSKVSFWEIDGRKQRTWCRNLCLLSKMFLDHKTLYYDVDPFMF
YIMTVKSAEGHHVVGYFSKEKESADGYNVACILTLPCYQKKGYGKLLIQFSYMLSSVEKK
VGSPEKPLSDLGLLSYRAYWTDTLVKLLVERNNPSLYRKNNPQAIPEEEENGNGSAASTP
GPGTASSSGVGTRSGLNAQPNFSNEITIEEISSITCMTTTDILHTLTTLQILRYYKGQHI
IVLTDQIMAMYEKLVKKVKEKKKHELDPRLLEWTPPSFTANQLRFGW
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaaatcacctggaagttgctcgagtaagaaacctttccagcattattcttggt
gaacatataatagagccatggtacttctcgccatatccgatagaattaacagaggaggac
gaaatttatatatgtgatttttcgttgtgctattttggatccaagaaacaatttgaaagg
tttagatcaaagtgtacattaaaacatcctccaggaaatgaaatttatagagattccaag
gttagcttttgggaaattgatggacgaaagcaaagaacatggtgcagaaatttgtgtttg
ctaagcaaaatgtttcttgatcataaaacattatactacgatgtcgatcctttcatgttt
tatatcatgacagtaaaatccgctgaaggtcatcatgtagtggggtacttctccaaagaa
aaagaaagtgctgatggatacaatgttgcttgtattttgacattaccatgttatcaaaaa
aaggggtacggtaagttgttgatccagttttcatatatgttgtcgagtgttgaaaagaaa
gtaggatcccctgagaaaccattatccgatttggggttgttatcatatcgtgcgtattgg
acggatacgttggtgaagttgttagttgagagaaacaatccaagtttatatcgtaagaac
aacccacaggctataccagaagaagaagagaatggtaatggttctgccgcatccacacca
ggacccgggactgcttcttcatcaggggttggtaccagactgggacttaatgctcaacca
aatttttccaatgaaatcacaatcgaagaaatatcatcaatcacttgcatgacgacaaca
gacattttgcatacgttaaccactttgcaaatattacgatactacaaaggtcagcatatt
attgtgttaacagatcaaattatggcaatgtatgaaaaattggtcaagaaagtaaaagag
aagaagaaacacgaattggatccaaggttattagaatggacaccaccactgtttacagcg
aatcaattacgttttggatggtag

DBGET integrated database retrieval system