KEGG   Chlamydia trachomatis G/11222: G11222_01100Help
Entry
G11222_01100      CDS       T01905                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ctq  Chlamydia trachomatis G/11222
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G11222_01100
   01230 Biosynthesis of amino acids
    G11222_01100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G11222_01100
   00030 Pentose phosphate pathway
    G11222_01100
   00051 Fructose and mannose metabolism
    G11222_01100
  Energy metabolism
   00680 Methane metabolism
    G11222_01100
Enzymes [BR:ctq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     G11222_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243648..244694
Genome map
AA seq 348 aa AA seqDB search
MTTIFDLLGKDADYLLNHKCVIKKEALTLPSGDLVSRVFAESDRNNRVLRSLQQMFSCGR
LGGTGYLSILPVDQGVEHTAGASFAKNPMYFDPENIVRLAMEAGCSAVASSYGVLSILAR
RYAHKIPFLLKLNHNELLSYPTTYHQIFFSQVEDAYNMGAVAVGATIYFGSESSSEEIVA
VAEAFARARELGLATVLWCYLRNPHFVVNNVDYHTAADLTGQADHLGATLGADIVKQKLP
TLQGGFKTINFSKTDDLVYSELSSNHPIDLCRYQVLNSYCGKVGLINSGGPSGQDDFAEA
VKTAVINKRAGGMGLILGRKAFQRPFSEGVRLLNLIQDIYLDPTISIS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatttttgatcttcttggtaaagacgccgactatctccttaaccacaagtgt
gttataaaaaaagaagctttaacgcttccttctggagacctcgtatcacgagtttttgca
gaatcagacagaaataatcgggtgctccgttcccttcaacagatgttcagttgtggacgc
ttaggcggaacaggatacctctctattctccctgttgaccaaggtgtcgaacatactgca
ggcgcatcgtttgccaagaatcctatgtactttgatccagaaaatatcgtgcgtctggct
atggaagctggctgttccgcggtagcttcttcctatggcgtgttaagtatattggctaga
cgatatgctcataaaattccttttttacttaaactaaaccacaacgaactgctatcctac
ccgacaacatatcaccaaatcttcttcagtcaagttgaagatgcctataatatgggagct
gttgctgtcggagcaacgatttactttggatcagagtcttcttctgaagaaattgttgct
gttgccgaagcttttgcaagagctagagagcttggcttggctacagtgttatggtgctat
ttaaggaatccacattttgttgtgaataatgtggattaccacactgctgccgatttaaca
gggcaagcggaccatcttggagcaactttaggagctgatatcgttaagcaaaagctccca
actcttcaaggaggatttaaaacaattaatttcagcaagactgatgatcttgtgtactcg
gagctttcatcaaaccaccctattgacctctgtcggtaccaggtacttaatagttactgt
ggaaaggttggtctaattaactccggaggcccttctgggcaagatgactttgctgaagca
gttaaaacagcagtaattaataaacgagctggtggcatgggactgattttagggagaaaa
gctttccagagacccttctctgaaggcgtccggttactcaatttaattcaagatatttat
ttagatccgacaatctccatatcataa

DBGET integrated database retrieval system