KEGG   Chlamydia trachomatis G/11222: G11222_01100Help
Entry
G11222_01100      CDS       T01905                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K11645  
fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ctq  Chlamydia trachomatis G/11222
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ctq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ctq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ctq00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ctq00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ctq00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:ctq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243648..244694
Genome map
AA seq 348 aa AA seqDB search
MTTIFDLLGKDADYLLNHKCVIKKEALTLPSGDLVSRVFAESDRNNRVLRSLQQMFSCGR
LGGTGYLSILPVDQGVEHTAGASFAKNPMYFDPENIVRLAMEAGCSAVASSYGVLSILAR
RYAHKIPFLLKLNHNELLSYPTTYHQIFFSQVEDAYNMGAVAVGATIYFGSESSSEEIVA
VAEAFARARELGLATVLWCYLRNPHFVVNNVDYHTAADLTGQADHLGATLGADIVKQKLP
TLQGGFKTINFSKTDDLVYSELSSNHPIDLCRYQVLNSYCGKVGLINSGGPSGQDDFAEA
VKTAVINKRAGGMGLILGRKAFQRPFSEGVRLLNLIQDIYLDPTISIS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatttttgatcttcttggtaaagacgccgactatctccttaaccacaagtgt
gttataaaaaaagaagctttaacgcttccttctggagacctcgtatcacgagtttttgca
gaatcagacagaaataatcgggtgctccgttcccttcaacagatgttcagttgtggacgc
ttaggcggaacaggatacctctctattctccctgttgaccaaggtgtcgaacatactgca
ggcgcatcgtttgccaagaatcctatgtactttgatccagaaaatatcgtgcgtctggct
atggaagctggctgttccgcggtagcttcttcctatggcgtgttaagtatattggctaga
cgatatgctcataaaattccttttttacttaaactaaaccacaacgaactgctatcctac
ccgacaacatatcaccaaatcttcttcagtcaagttgaagatgcctataatatgggagct
gttgctgtcggagcaacgatttactttggatcagagtcttcttctgaagaaattgttgct
gttgccgaagcttttgcaagagctagagagcttggcttggctacagtgttatggtgctat
ttaaggaatccacattttgttgtgaataatgtggattaccacactgctgccgatttaaca
gggcaagcggaccatcttggagcaactttaggagctgatatcgttaagcaaaagctccca
actcttcaaggaggatttaaaacaattaatttcagcaagactgatgatcttgtgtactcg
gagctttcatcaaaccaccctattgacctctgtcggtaccaggtacttaatagttactgt
ggaaaggttggtctaattaactccggaggcccttctgggcaagatgactttgctgaagca
gttaaaacagcagtaattaataaacgagctggtggcatgggactgattttagggagaaaa
gctttccagagacccttctctgaaggcgtccggttactcaatttaattcaagatatttat
ttagatccgacaatctccatatcataa

DBGET integrated database retrieval system