KEGG   Chlamydia trachomatis G/11222: G11222_03455Help
Entry
G11222_03455      CDS       T01905                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctq  Chlamydia trachomatis G/11222
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    G11222_03455
Enzymes [BR:ctq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     G11222_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
748332..749822
Genome map
AA seq 496 aa AA seqDB search
MNVNQHVQDIVQSLLAQHILLPFDIAFAQKHISQEEVSQEAEAFLATASALLRCGYPYFS
ICDKTIHPTLPGISSKQLFEWFQVLSSRIKEELFEVVNHKIYLRSLFLLREKVFHKLHRL
AGAVPRTPLIFEEIAQLSEEQNQVLKTVLNSCFSLVCGGPGTGKTFLAVQMIRLILAQIP
SAQIVVASPTGKASAHLHSVLTSQGIVGDSVEVVTIHKFLKDMRRGCSPVDLLLVDEGSM
VTINLLHGLIKTIRGEARGETIYADRMVIFGDANQLPPIGIGVGNPFHEVVSEFSKQACF
LSTSHRAKHKELQELASAVLRKELIPFQPLPSRQEAIRRLSFAFTQAAKEGVSLCALTPM
RQGLWGFLQLNRLLFNEMQEKHPQAPIPIIVTERYETWGLTNGDTGVLDPVTQQLRFTNG
EILHQADFPYYSYNYVMSVHKSQGSEYDRVIVILPKGSEVFDSAILYTAITRTKQHVEIW
ADREALEAIILKRGRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaatcagcacgttcaagatattgtacaatctttgttagcacaacatattctt
ctcccttttgatatagcctttgctcaaaagcatatatcccaggaggaggttagtcaggaa
gcagaggctttcttagctacagcctctgcattattgcgttgtggatatccttatttttct
atctgtgataagacgattcatcccacgctcccagggatttcaagtaaacaactcttcgaa
tggttccaagtgttatcttctcgtataaaagaagaactgtttgaagtcgttaatcataaa
atctacctacgctcattatttcttttacgggagaaagtgtttcataagttgcataggttg
gcaggagctgtaccacgcacgcccttgatttttgaagagattgcacagctctcggaagag
cagaaccaagtacttaaaactgtattaaactcctgcttctctctcgtttgtggaggacca
ggaacaggaaaaacatttttagcagttcagatgattcggttgatacttgcgcaaattcct
tcagcgcagattgtagtagcttccccaacggggaaagcttccgctcatctgcatagcgta
ttaacatctcaggggatcgttggagattctgtagaagtcgttacgattcataaattttta
aaagatatgcgtagagggtgctcccctgtagatctactattggttgatgaaggatcgatg
gtgaccataaatctgttacatggactaatcaaaaccatacgaggagaagctcgaggggaa
acgatctatgcagatagaatggtgatttttggggatgcgaatcagcttcctccaataggt
attggagtgggaaatccttttcatgaagtagtgtctgagttttctaaacaggcatgcttt
ttatctaccagccaccgagctaaacataaggaattacaggaattagcgagcgctgttctg
cgcaaggagctgattccttttcaacctttgccttcccgacaagaagctattcggcgattg
tcttttgcttttacacaagcagcaaaagaaggggtgtcgttatgtgctttgactccgatg
cgccaaggactttgggggtttttgcagttgaatcggttgttgtttaatgagatgcaggag
aaacatccgcaggcgcctattcctatcatcgtgacagaaagatatgaaacgtggggatta
acgaatggggatacaggagttttagatcctgtaacgcaacaattgcgtttcacgaatggg
gagattctgcatcaagcagattttccctattattcttacaactatgtcatgtctgtgcac
aaaagtcagggtagtgaatatgatcgtgtgattgtcattcttcctaaaggcagtgaagtc
tttgattcggcaattctctatactgcaattacaagaaccaaacaacacgttgagatttgg
gctgatcgagaagctttagaggcgatcattttgaaaagagggcgttattaa

DBGET integrated database retrieval system