KEGG   Chlamydia trachomatis G/11222: G11222_03840Help
Entry
G11222_03840      CDS       T01905                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ctq  Chlamydia trachomatis G/11222
Pathway
ctq00010  Glycolysis / Gluconeogenesis
ctq00260  Glycine, serine and threonine metabolism
ctq00680  Methane metabolism
ctq01100  Metabolic pathways
ctq01110  Biosynthesis of secondary metabolites
ctq01120  Microbial metabolism in diverse environments
ctq01130  Biosynthesis of antibiotics
ctq01200  Carbon metabolism
ctq01230  Biosynthesis of amino acids
Module
ctq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ctq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G11222_03840
  Energy metabolism
   00680 Methane metabolism
    G11222_03840
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G11222_03840
Enzymes [BR:ctq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     G11222_03840
Membrane trafficking [BR:ctq04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    G11222_03840
Exosome [BR:ctq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   G11222_03840
  Exosomal proteins of melanoma cells
   G11222_03840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADH19366
Position
complement(833704..834384)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
ITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgtatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
ataacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system