KEGG   Chlamydia trachomatis IU824: BN197_4391Help
Entry
BN197_4391        CDS       T02493                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ctri  Chlamydia trachomatis IU824
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctri00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN197_4391
Enzymes [BR:ctri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN197_4391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503997..504668
Genome map
AA seq 223 aa AA seqDB search
MPLYLGLNPSSAKQYSAVFQPIIRIVPFSKHVPQIRHARKFLVSASHILLTSPSSTACFF
SSIRKRIPLSLFRNKSFVTIGEATSSRVKAFLPKANIVQSAFPQAEAFLPILSTLPSSSS
LLYPHSVLARPILRSLLQTLPFSSFSYPHYTVKPITLSVSTFLPHKTIILTSPSIVRAYA
QLFPCLPDKEHWCLGEISAAEFKQIFHTPPSKILFSTKEPTGC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtacttaggcctcaatccatcctctgctaaacaatattctgctgtttttcag
cctattattcgcatagtccctttttcaaaacacgttcctcaaatacgacatgctaggaag
ttccttgtatcagcttcccatattttgttaacaagcccctcttctaccgcttgttttttt
tcttccattaggaaaagaatccctttatccctgttcaggaataaatccttcgttaccata
ggagaagccacttcttctcgtgtaaaggcctttctccccaaagctaatattgtgcaaagc
gcattccctcaagcagaagcatttcttcccatcctatcgactcttccttccagctcctcc
ctactctatcctcactctgtactcgctcgtcccattctccgctctcttctacaaacactc
cctttctcctccttttcctatcctcattacacagttaaacccattacactttccgtaagt
acctttcttccccataaaactattattctcactagcccttctatcgttcgtgcctatgca
caactatttccctgcctccctgataaagaacactggtgtctaggagagattagtgcagca
gaattcaaacagatatttcacactcctccttccaaaattcttttttcaactaaagaaccg
acaggatgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system